Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545A2W0

Protein Details
Accession A0A545A2W0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-43DASSARIKRNKKSSQTKFKVRCQRYHydrophilic
NLS Segment(s)
PositionSequence
26-29KRNK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPRETSDIKQFIEICRRKDASSARIKRNKKSSQTKFKVRCQRYLYTLVLKDSEKVEKLKQSLPPSQSFPPHDLKEFGNFPIILLNFIIPDLVIADTPKKNAKGKRTAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.47
4 0.43
5 0.49
6 0.5
7 0.48
8 0.54
9 0.59
10 0.61
11 0.68
12 0.73
13 0.75
14 0.78
15 0.78
16 0.77
17 0.79
18 0.8
19 0.82
20 0.85
21 0.88
22 0.85
23 0.86
24 0.86
25 0.78
26 0.77
27 0.71
28 0.66
29 0.6
30 0.58
31 0.51
32 0.45
33 0.43
34 0.35
35 0.31
36 0.27
37 0.23
38 0.19
39 0.19
40 0.15
41 0.16
42 0.17
43 0.18
44 0.21
45 0.24
46 0.28
47 0.31
48 0.35
49 0.37
50 0.38
51 0.38
52 0.39
53 0.4
54 0.37
55 0.36
56 0.36
57 0.35
58 0.34
59 0.31
60 0.3
61 0.3
62 0.29
63 0.25
64 0.22
65 0.2
66 0.19
67 0.21
68 0.2
69 0.15
70 0.14
71 0.14
72 0.1
73 0.1
74 0.1
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.12
82 0.14
83 0.17
84 0.23
85 0.28
86 0.35
87 0.43
88 0.51