Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZVR0

Protein Details
Accession A0A544ZVR0   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-53FAEPNRQRLRWDKKSKKYVSRDNDEDHydrophilic
161-186IDDIRRARKEKEQRKAKNARPAKKRNBasic
NLS Segment(s)
PositionSequence
133-186RKKRVNEARENRVGRFKDGMGSKREIKGIDDIRRARKEKEQRKAKNARPAKKRN
Subcellular Location(s) cyto 3, cyto_nucl 12, mito 3, nucl 19
Family & Domain DBs
InterPro View protein in InterPro  
IPR012541  DBP10_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0003723  F:RNA binding  
GO:0003724  F:RNA helicase activity  
Pfam View protein in Pfam  
PF08147  DBP10CT  
Amino Acid Sequences HSGGGSTFIEAARDATMDLGNDETAKGFAEPNRQRLRWDKKSKKYVSRDNDEDGSKGAKMVVGESGVKIAASFQSGRYAKWRTANRIGRVPRTGDAEKSGNASLLPKGGVRYKHNQEKAPKAADKYRDDYEVRKKRVNEARENRVGRFKDGMGSKREIKGIDDIRRARKEKEQRKAKNARPAKKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.09
5 0.1
6 0.1
7 0.09
8 0.09
9 0.09
10 0.08
11 0.08
12 0.08
13 0.08
14 0.1
15 0.12
16 0.23
17 0.28
18 0.37
19 0.45
20 0.45
21 0.49
22 0.57
23 0.64
24 0.64
25 0.71
26 0.72
27 0.74
28 0.85
29 0.89
30 0.89
31 0.88
32 0.88
33 0.85
34 0.84
35 0.78
36 0.71
37 0.66
38 0.57
39 0.48
40 0.39
41 0.31
42 0.22
43 0.18
44 0.13
45 0.1
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.09
53 0.07
54 0.07
55 0.06
56 0.06
57 0.05
58 0.06
59 0.07
60 0.07
61 0.15
62 0.16
63 0.17
64 0.22
65 0.24
66 0.25
67 0.32
68 0.36
69 0.35
70 0.45
71 0.51
72 0.49
73 0.55
74 0.55
75 0.52
76 0.49
77 0.44
78 0.36
79 0.34
80 0.32
81 0.24
82 0.24
83 0.22
84 0.2
85 0.2
86 0.18
87 0.13
88 0.12
89 0.12
90 0.09
91 0.08
92 0.09
93 0.07
94 0.08
95 0.12
96 0.16
97 0.2
98 0.28
99 0.35
100 0.44
101 0.48
102 0.53
103 0.56
104 0.6
105 0.61
106 0.59
107 0.54
108 0.49
109 0.5
110 0.52
111 0.5
112 0.46
113 0.43
114 0.41
115 0.39
116 0.42
117 0.48
118 0.5
119 0.5
120 0.51
121 0.51
122 0.56
123 0.63
124 0.64
125 0.64
126 0.63
127 0.67
128 0.71
129 0.73
130 0.65
131 0.65
132 0.59
133 0.51
134 0.45
135 0.37
136 0.34
137 0.37
138 0.39
139 0.36
140 0.39
141 0.41
142 0.41
143 0.43
144 0.37
145 0.33
146 0.37
147 0.41
148 0.44
149 0.48
150 0.51
151 0.58
152 0.66
153 0.67
154 0.62
155 0.64
156 0.67
157 0.69
158 0.73
159 0.75
160 0.77
161 0.84
162 0.91
163 0.89
164 0.89
165 0.88
166 0.87