Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZZS8

Protein Details
Accession A0A544ZZS8    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKGKSTGRNVRPRSVKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
4-27GKSTGRNVRPRSVKKKKDPNAPKR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKGKSTGRNVRPRSVKKKKDPNAPKRGLSAYMIFANEKRENVRDENPGITFGQVGKVLGKLWKELDDKQRSQYEVKAAEDKKRYEDEKANYNPDAEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.84
5 0.9
6 0.9
7 0.9
8 0.91
9 0.91
10 0.91
11 0.87
12 0.79
13 0.72
14 0.65
15 0.56
16 0.47
17 0.38
18 0.29
19 0.25
20 0.23
21 0.19
22 0.17
23 0.21
24 0.2
25 0.19
26 0.19
27 0.19
28 0.22
29 0.25
30 0.28
31 0.26
32 0.26
33 0.27
34 0.25
35 0.24
36 0.21
37 0.17
38 0.13
39 0.09
40 0.09
41 0.07
42 0.07
43 0.06
44 0.07
45 0.07
46 0.09
47 0.1
48 0.1
49 0.11
50 0.16
51 0.18
52 0.24
53 0.33
54 0.39
55 0.4
56 0.44
57 0.47
58 0.44
59 0.43
60 0.41
61 0.38
62 0.34
63 0.35
64 0.38
65 0.36
66 0.42
67 0.46
68 0.45
69 0.43
70 0.46
71 0.45
72 0.44
73 0.5
74 0.47
75 0.51
76 0.56
77 0.56
78 0.5
79 0.49
80 0.42
81 0.35
82 0.35