Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A544ZYM3

Protein Details
Accession A0A544ZYM3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-44EAQEKKKTPKGRAKKRILYTRRFBasic
NLS Segment(s)
PositionSequence
19-37PKVEAQEKKKTPKGRAKKR
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEAQEKKKTPKGRAKKRILYTRRFVNVTLTGGKRKLHQMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.46
4 0.45
5 0.46
6 0.53
7 0.52
8 0.57
9 0.56
10 0.57
11 0.6
12 0.61
13 0.65
14 0.64
15 0.66
16 0.66
17 0.7
18 0.72
19 0.73
20 0.78
21 0.8
22 0.82
23 0.84
24 0.86
25 0.83
26 0.79
27 0.74
28 0.72
29 0.67
30 0.59
31 0.51
32 0.46
33 0.41
34 0.37
35 0.37
36 0.31
37 0.31
38 0.32
39 0.33
40 0.31
41 0.38
42 0.43
43 0.46
44 0.54
45 0.6