Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545A192

Protein Details
Accession A0A545A192    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-32HRSPQSGLKNFNKRPREKKRDPAFIPFAHydrophilic
NLS Segment(s)
PositionSequence
17-24KRPREKKR
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 7
Family & Domain DBs
Amino Acid Sequences AIINHRSPQSGLKNFNKRPREKKRDPAFIPFARLNIYIIWNMSHPPESATTTSKPSSFEFLRAEILDEISQACYTSFFCYFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.77
3 0.79
4 0.78
5 0.81
6 0.84
7 0.85
8 0.84
9 0.87
10 0.88
11 0.88
12 0.83
13 0.8
14 0.77
15 0.68
16 0.64
17 0.53
18 0.44
19 0.35
20 0.32
21 0.24
22 0.16
23 0.16
24 0.11
25 0.11
26 0.11
27 0.09
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.1
34 0.12
35 0.13
36 0.16
37 0.17
38 0.2
39 0.21
40 0.21
41 0.22
42 0.21
43 0.25
44 0.23
45 0.25
46 0.24
47 0.24
48 0.26
49 0.23
50 0.24
51 0.19
52 0.2
53 0.15
54 0.14
55 0.13
56 0.11
57 0.11
58 0.09
59 0.09
60 0.08
61 0.09
62 0.13