Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V6W9

Protein Details
Accession H1V6W9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
171-195ASFRGLKTRREGKKGKKAVEKEAAAHydrophilic
NLS Segment(s)
PositionSequence
176-191LKTRREGKKGKKAVEK
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000456  Ribosomal_L17  
IPR036373  Ribosomal_L17_sf  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG chig:CH63R_09343  -  
Pfam View protein in Pfam  
PF01196  Ribosomal_L17  
PROSITE View protein in PROSITE  
PS01167  RIBOSOMAL_L17  
Amino Acid Sequences MAGGLVKYRHLSRNSSARQALLRGLVTSLVAHEHIQTTYAKAKEAQRLAEKLITYAKRDNEETRRKAQAILYTPHDLLPKLFGELRQRYTERPGGYTRVLRTEPRNTYDQAPSAILELVDGPRDARFMMTAKAVAFDKDSGKRHTELTMKNVAKVTRYRKDGKTAFDDMVASFRGLKTRREGKKGKKAVEKEAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.55
4 0.51
5 0.49
6 0.46
7 0.41
8 0.34
9 0.29
10 0.21
11 0.2
12 0.17
13 0.15
14 0.13
15 0.11
16 0.09
17 0.09
18 0.09
19 0.09
20 0.11
21 0.1
22 0.12
23 0.12
24 0.13
25 0.19
26 0.19
27 0.19
28 0.22
29 0.28
30 0.34
31 0.37
32 0.39
33 0.39
34 0.4
35 0.42
36 0.41
37 0.35
38 0.29
39 0.33
40 0.29
41 0.27
42 0.3
43 0.3
44 0.3
45 0.34
46 0.39
47 0.42
48 0.5
49 0.51
50 0.52
51 0.53
52 0.5
53 0.5
54 0.45
55 0.42
56 0.37
57 0.36
58 0.34
59 0.32
60 0.32
61 0.31
62 0.29
63 0.22
64 0.17
65 0.16
66 0.12
67 0.11
68 0.12
69 0.12
70 0.19
71 0.23
72 0.26
73 0.28
74 0.29
75 0.29
76 0.33
77 0.35
78 0.28
79 0.27
80 0.26
81 0.25
82 0.26
83 0.28
84 0.24
85 0.23
86 0.24
87 0.23
88 0.26
89 0.31
90 0.31
91 0.31
92 0.33
93 0.31
94 0.33
95 0.32
96 0.29
97 0.22
98 0.2
99 0.17
100 0.15
101 0.14
102 0.1
103 0.08
104 0.07
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.09
116 0.09
117 0.1
118 0.1
119 0.12
120 0.12
121 0.11
122 0.11
123 0.12
124 0.16
125 0.21
126 0.25
127 0.26
128 0.29
129 0.3
130 0.3
131 0.34
132 0.37
133 0.34
134 0.36
135 0.42
136 0.4
137 0.41
138 0.43
139 0.39
140 0.35
141 0.4
142 0.43
143 0.41
144 0.47
145 0.52
146 0.52
147 0.62
148 0.62
149 0.61
150 0.59
151 0.55
152 0.49
153 0.43
154 0.39
155 0.3
156 0.27
157 0.22
158 0.16
159 0.13
160 0.13
161 0.19
162 0.2
163 0.24
164 0.31
165 0.4
166 0.48
167 0.56
168 0.66
169 0.7
170 0.79
171 0.84
172 0.84
173 0.84
174 0.82
175 0.82