Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZWY2

Protein Details
Accession A0A544ZWY2   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-37PPDFDPSKIPRRKQPKEQQQTVRLMAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7, mito 16, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR002915  DeoC/FbaB/LacD_aldolase  
IPR007590  Saf4/Yju2  
IPR043701  Yju2  
Gene Ontology GO:0071006  C:U2-type catalytic step 1 spliceosome  
GO:0016829  F:lyase activity  
GO:0046872  F:metal ion binding  
GO:0000349  P:generation of catalytic spliceosome for first transesterification step  
Pfam View protein in Pfam  
PF04502  Saf4_Yju2  
Amino Acid Sequences MADRKALNHYYPPDFDPSKIPRRKQPKEQQQTVRLMAPFSMRCNSCAEYIYKGRKFNARKELVVGQDYYGIKIFRFYIKCTRCSAEITFKTDPKNADYVAEHGASRNVVPMKDDRAEEGDELLTEEEKVKACELSVSGGADFVKTSTGFGPGGATAEDIALMRRTVGPKLGVKASGGIRNVETARAMIAAGATRIGASASVAIVSGGQGEGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.4
4 0.43
5 0.48
6 0.54
7 0.57
8 0.59
9 0.69
10 0.76
11 0.79
12 0.82
13 0.83
14 0.86
15 0.9
16 0.9
17 0.87
18 0.85
19 0.77
20 0.7
21 0.59
22 0.49
23 0.4
24 0.36
25 0.29
26 0.26
27 0.29
28 0.24
29 0.25
30 0.29
31 0.29
32 0.26
33 0.26
34 0.25
35 0.25
36 0.32
37 0.4
38 0.4
39 0.41
40 0.42
41 0.49
42 0.52
43 0.55
44 0.58
45 0.54
46 0.5
47 0.51
48 0.53
49 0.47
50 0.44
51 0.35
52 0.25
53 0.26
54 0.25
55 0.21
56 0.18
57 0.15
58 0.13
59 0.14
60 0.15
61 0.16
62 0.17
63 0.2
64 0.29
65 0.32
66 0.35
67 0.37
68 0.38
69 0.33
70 0.35
71 0.35
72 0.35
73 0.34
74 0.37
75 0.37
76 0.37
77 0.38
78 0.37
79 0.35
80 0.27
81 0.26
82 0.2
83 0.19
84 0.17
85 0.17
86 0.16
87 0.16
88 0.13
89 0.11
90 0.11
91 0.1
92 0.09
93 0.1
94 0.09
95 0.08
96 0.1
97 0.11
98 0.14
99 0.16
100 0.16
101 0.14
102 0.16
103 0.16
104 0.15
105 0.14
106 0.11
107 0.09
108 0.09
109 0.08
110 0.06
111 0.05
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.08
125 0.09
126 0.09
127 0.08
128 0.08
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.09
135 0.09
136 0.09
137 0.1
138 0.08
139 0.09
140 0.08
141 0.08
142 0.06
143 0.06
144 0.06
145 0.05
146 0.06
147 0.06
148 0.06
149 0.07
150 0.1
151 0.11
152 0.12
153 0.15
154 0.19
155 0.22
156 0.25
157 0.27
158 0.25
159 0.24
160 0.27
161 0.28
162 0.29
163 0.26
164 0.24
165 0.22
166 0.26
167 0.26
168 0.22
169 0.19
170 0.14
171 0.13
172 0.12
173 0.11
174 0.07
175 0.08
176 0.07
177 0.07
178 0.07
179 0.06
180 0.06
181 0.06
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.06