Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZWH7

Protein Details
Accession A0A544ZWH7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
11-37IPKTRNTYCKGKECRKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 10, mito 8, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences ADTLSPIQVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVKCKAKSQLALKRCKHFELGYVFSIASGIMPGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.48
4 0.55
5 0.56
6 0.62
7 0.68
8 0.73
9 0.75
10 0.76
11 0.82
12 0.81
13 0.84
14 0.85
15 0.86
16 0.83
17 0.85
18 0.87
19 0.8
20 0.79
21 0.73
22 0.68
23 0.6
24 0.55
25 0.44
26 0.36
27 0.34
28 0.33
29 0.32
30 0.29
31 0.34
32 0.38
33 0.42
34 0.47
35 0.51
36 0.48
37 0.55
38 0.62
39 0.59
40 0.61
41 0.59
42 0.58
43 0.57
44 0.59
45 0.5
46 0.45
47 0.41
48 0.34
49 0.35
50 0.36
51 0.35
52 0.29
53 0.36
54 0.4
55 0.49
56 0.57
57 0.6
58 0.59
59 0.63
60 0.7
61 0.71
62 0.69
63 0.64
64 0.61
65 0.62
66 0.61
67 0.59
68 0.54
69 0.53
70 0.47
71 0.46
72 0.47
73 0.43
74 0.45
75 0.5
76 0.55
77 0.57
78 0.66
79 0.68
80 0.69
81 0.67
82 0.62
83 0.56
84 0.48
85 0.46
86 0.43
87 0.42
88 0.34
89 0.32
90 0.3
91 0.25
92 0.24
93 0.18
94 0.1
95 0.06
96 0.05
97 0.07
98 0.08
99 0.1
100 0.15
101 0.16
102 0.17
103 0.19
104 0.22