Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1W205

Protein Details
Accession H1W205    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-134EWQWLKMRRDRERTRERARKREREREIRLTSPBasic
NLS Segment(s)
PositionSequence
109-127MRRDRERTRERARKRERER
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MAVSIITLHYDTAGSTHAIQLIPGGPRKSQEEQEKERHGRMSLQGKEETCFHASILSQPAASLPHYQNNNINKPTDFSFRMGRNHRPAAQHLQTPQGRTSSSEWQWLKMRRDRERTRERARKREREREIRLTSPLSFPSRTRAGYKNFVKPEPVCMAGLAVSRALVSHSTWQPCKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.12
5 0.12
6 0.12
7 0.13
8 0.14
9 0.17
10 0.21
11 0.22
12 0.2
13 0.23
14 0.29
15 0.33
16 0.37
17 0.44
18 0.48
19 0.53
20 0.61
21 0.68
22 0.66
23 0.65
24 0.59
25 0.51
26 0.45
27 0.45
28 0.46
29 0.41
30 0.42
31 0.42
32 0.4
33 0.4
34 0.38
35 0.34
36 0.26
37 0.22
38 0.17
39 0.15
40 0.14
41 0.16
42 0.19
43 0.15
44 0.13
45 0.13
46 0.13
47 0.13
48 0.14
49 0.16
50 0.13
51 0.19
52 0.2
53 0.22
54 0.28
55 0.33
56 0.38
57 0.35
58 0.35
59 0.29
60 0.3
61 0.31
62 0.3
63 0.25
64 0.21
65 0.25
66 0.27
67 0.33
68 0.36
69 0.4
70 0.41
71 0.43
72 0.45
73 0.41
74 0.42
75 0.43
76 0.4
77 0.36
78 0.31
79 0.35
80 0.33
81 0.33
82 0.3
83 0.23
84 0.21
85 0.21
86 0.24
87 0.24
88 0.23
89 0.3
90 0.29
91 0.31
92 0.38
93 0.42
94 0.45
95 0.43
96 0.51
97 0.51
98 0.61
99 0.66
100 0.7
101 0.74
102 0.76
103 0.82
104 0.83
105 0.83
106 0.84
107 0.87
108 0.87
109 0.86
110 0.88
111 0.87
112 0.87
113 0.87
114 0.86
115 0.81
116 0.73
117 0.67
118 0.59
119 0.5
120 0.42
121 0.38
122 0.32
123 0.28
124 0.26
125 0.29
126 0.3
127 0.31
128 0.34
129 0.36
130 0.38
131 0.46
132 0.52
133 0.56
134 0.56
135 0.55
136 0.57
137 0.51
138 0.51
139 0.46
140 0.41
141 0.32
142 0.27
143 0.26
144 0.22
145 0.22
146 0.16
147 0.12
148 0.1
149 0.09
150 0.09
151 0.1
152 0.09
153 0.1
154 0.17
155 0.24
156 0.31