Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VYW2

Protein Details
Accession H1VYW2    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-61EDEDERPKKKPKKWFQDDSDEEREKKKRAKKGGKVLEIDBasic
NLS Segment(s)
PositionSequence
28-36RPKKKPKKW
44-56EREKKKRAKKGGK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences SRRALMGPLPIPGGGGGDSGGEEDEDERPKKKPKKWFQDDSDEEREKKKRAKKGGKVLEIDREPETLEDLEALASGLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.05
5 0.06
6 0.05
7 0.06
8 0.04
9 0.04
10 0.05
11 0.08
12 0.12
13 0.14
14 0.15
15 0.19
16 0.29
17 0.37
18 0.43
19 0.52
20 0.58
21 0.68
22 0.76
23 0.81
24 0.77
25 0.79
26 0.76
27 0.73
28 0.7
29 0.61
30 0.53
31 0.49
32 0.48
33 0.42
34 0.45
35 0.45
36 0.46
37 0.55
38 0.65
39 0.69
40 0.76
41 0.82
42 0.81
43 0.78
44 0.72
45 0.69
46 0.6
47 0.53
48 0.43
49 0.33
50 0.27
51 0.23
52 0.23
53 0.14
54 0.13
55 0.1
56 0.09
57 0.09
58 0.08
59 0.08