Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZQN7

Protein Details
Accession A0A544ZQN7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
92-117LYRMRSRTGRMILRRRKLKGRRSVAAHydrophilic
NLS Segment(s)
PositionSequence
93-115YRMRSRTGRMILRRRKLKGRRSV
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFALTRIARPLLRQSIRTFTSLAPHRPSLTPLRITSPATATAAPSLSAEFDLVAKDAVSSHPSLMTQQLRFGPRNTMNGHTRLVQKRRHGFLYRMRSRTGRMILRRRKLKGRRSVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.48
4 0.47
5 0.4
6 0.31
7 0.36
8 0.38
9 0.4
10 0.37
11 0.37
12 0.38
13 0.37
14 0.4
15 0.38
16 0.38
17 0.37
18 0.33
19 0.36
20 0.36
21 0.37
22 0.34
23 0.29
24 0.25
25 0.21
26 0.2
27 0.16
28 0.14
29 0.12
30 0.11
31 0.09
32 0.08
33 0.06
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.12
52 0.15
53 0.14
54 0.16
55 0.2
56 0.24
57 0.25
58 0.26
59 0.28
60 0.28
61 0.32
62 0.32
63 0.34
64 0.34
65 0.35
66 0.35
67 0.32
68 0.37
69 0.4
70 0.45
71 0.46
72 0.52
73 0.57
74 0.61
75 0.64
76 0.6
77 0.58
78 0.61
79 0.66
80 0.66
81 0.61
82 0.59
83 0.54
84 0.54
85 0.55
86 0.53
87 0.51
88 0.52
89 0.6
90 0.67
91 0.75
92 0.8
93 0.79
94 0.82
95 0.83
96 0.83
97 0.83