Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZT65

Protein Details
Accession A0A544ZT65   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-121DQSARRTKEITPNRKKTRHPESHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, cyto_nucl 14.5, nucl 17.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MVLDEATSAVDMATDSLIQRSIREEFDDSTLLVIAHRLSTIADFDRILVLGAGEVVEFGTPNELWHKEDGLFRDMCEHSGEKEELKKIITLIIKDNLPVDQSARRTKEITPNRKKTRHPES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.1
5 0.1
6 0.11
7 0.13
8 0.15
9 0.16
10 0.19
11 0.21
12 0.19
13 0.22
14 0.22
15 0.19
16 0.17
17 0.15
18 0.12
19 0.1
20 0.09
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.06
27 0.08
28 0.08
29 0.09
30 0.08
31 0.09
32 0.09
33 0.08
34 0.08
35 0.06
36 0.05
37 0.04
38 0.04
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.04
47 0.04
48 0.04
49 0.07
50 0.08
51 0.09
52 0.1
53 0.11
54 0.12
55 0.14
56 0.16
57 0.17
58 0.16
59 0.15
60 0.2
61 0.19
62 0.18
63 0.19
64 0.17
65 0.14
66 0.18
67 0.19
68 0.16
69 0.2
70 0.21
71 0.2
72 0.2
73 0.2
74 0.16
75 0.2
76 0.21
77 0.18
78 0.21
79 0.23
80 0.22
81 0.22
82 0.23
83 0.18
84 0.17
85 0.16
86 0.14
87 0.16
88 0.22
89 0.3
90 0.33
91 0.36
92 0.37
93 0.41
94 0.49
95 0.54
96 0.6
97 0.63
98 0.7
99 0.77
100 0.84
101 0.87