Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545AAU1

Protein Details
Accession A0A545AAU1   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
175-197LNEANKMKTHNEKRKRQEEMMSAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 4, mito 20, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040049  MRPS25  
IPR007741  Ribosome/NADH_DH  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF05047  L51_S25_CI-B8  
Amino Acid Sequences MTGSVLQRAIKLHKLLSIKVGPAAVSLPANIVGIHLAISKKKSTESNAIHQSAKKFWHKFLPQLKYHNPQVPITVDRQVEPTCSSELTIYFNDSRVTVTTPSDPKTSGKQTSTEFISDKGATSLKTTKKLINMNGRSPEVILDEFVQATKARATQPSEKDLQLIQWLERASENSLNEANKMKTHNEKRKRQEEMMSAAKGVMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.38
4 0.37
5 0.32
6 0.31
7 0.3
8 0.24
9 0.21
10 0.21
11 0.15
12 0.12
13 0.1
14 0.09
15 0.09
16 0.1
17 0.09
18 0.08
19 0.07
20 0.06
21 0.07
22 0.08
23 0.09
24 0.11
25 0.14
26 0.16
27 0.17
28 0.2
29 0.24
30 0.27
31 0.36
32 0.38
33 0.45
34 0.51
35 0.52
36 0.52
37 0.51
38 0.48
39 0.42
40 0.43
41 0.43
42 0.38
43 0.37
44 0.45
45 0.45
46 0.51
47 0.57
48 0.58
49 0.55
50 0.6
51 0.64
52 0.6
53 0.63
54 0.6
55 0.53
56 0.45
57 0.42
58 0.38
59 0.33
60 0.29
61 0.28
62 0.23
63 0.21
64 0.23
65 0.21
66 0.19
67 0.18
68 0.18
69 0.13
70 0.13
71 0.13
72 0.11
73 0.11
74 0.12
75 0.11
76 0.12
77 0.12
78 0.12
79 0.12
80 0.12
81 0.12
82 0.1
83 0.11
84 0.09
85 0.1
86 0.14
87 0.15
88 0.17
89 0.17
90 0.18
91 0.18
92 0.22
93 0.26
94 0.26
95 0.25
96 0.26
97 0.26
98 0.28
99 0.28
100 0.25
101 0.2
102 0.17
103 0.19
104 0.16
105 0.15
106 0.13
107 0.12
108 0.11
109 0.13
110 0.19
111 0.2
112 0.25
113 0.27
114 0.28
115 0.33
116 0.38
117 0.43
118 0.47
119 0.48
120 0.49
121 0.51
122 0.49
123 0.43
124 0.38
125 0.32
126 0.23
127 0.18
128 0.14
129 0.1
130 0.1
131 0.1
132 0.1
133 0.1
134 0.08
135 0.09
136 0.09
137 0.1
138 0.12
139 0.16
140 0.22
141 0.29
142 0.33
143 0.38
144 0.4
145 0.38
146 0.37
147 0.33
148 0.3
149 0.27
150 0.24
151 0.19
152 0.19
153 0.19
154 0.18
155 0.19
156 0.19
157 0.18
158 0.21
159 0.21
160 0.21
161 0.25
162 0.24
163 0.25
164 0.28
165 0.26
166 0.25
167 0.27
168 0.3
169 0.37
170 0.48
171 0.57
172 0.62
173 0.71
174 0.78
175 0.85
176 0.87
177 0.83
178 0.8
179 0.76
180 0.74
181 0.71
182 0.62
183 0.52