Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VFI7

Protein Details
Accession H1VFI7   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-59LSIHPESKKRGRPKRRSRKKAKDGRANIRGLBasic
NLS Segment(s)
PositionSequence
35-54SKKRGRPKRRSRKKAKDGRA
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences QYFRFARPKTFVGRLASSSVHDAGPILPLSIHPESKKRGRPKRRSRKKAKDGRANIRGLPDHDGDPIEGGSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.37
4 0.31
5 0.28
6 0.24
7 0.18
8 0.15
9 0.13
10 0.11
11 0.12
12 0.1
13 0.08
14 0.06
15 0.06
16 0.12
17 0.13
18 0.15
19 0.14
20 0.18
21 0.22
22 0.3
23 0.37
24 0.43
25 0.52
26 0.61
27 0.71
28 0.79
29 0.86
30 0.9
31 0.94
32 0.95
33 0.96
34 0.95
35 0.95
36 0.94
37 0.93
38 0.92
39 0.91
40 0.87
41 0.79
42 0.69
43 0.64
44 0.56
45 0.47
46 0.41
47 0.33
48 0.26
49 0.25
50 0.24
51 0.19
52 0.18
53 0.16