Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZVM4

Protein Details
Accession A0A544ZVM4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-44GEVKSEKQLKKEQKKAEKQAKFDQKNHydrophilic
NLS Segment(s)
PositionSequence
25-68KQLKKEQKKAEKQAKFDQKNASKAKAAPATGEPSKKKAAKEKKA
Subcellular Location(s) cyto 14.5, cyto_nucl 11, nucl 6.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002300  aa-tRNA-synth_Ia  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002303  Valyl-tRNA_ligase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004832  F:valine-tRNA ligase activity  
GO:0006438  P:valyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00133  tRNA-synt_1  
Amino Acid Sequences AADGGKVYTSADSTAGNNGEVKSEKQLKKEQKKAEKQAKFDQKNASKAKAAPATGEPSKKKAAKEKKAEAVVLPPFVEETAEGEKKKIKSFEDPYYSSYHPVAVESAWYSWWEKEGFFKPQFTPEGDVKPEGKFVIVVPPPNVTGALQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.16
5 0.15
6 0.18
7 0.18
8 0.19
9 0.23
10 0.32
11 0.35
12 0.39
13 0.49
14 0.56
15 0.65
16 0.73
17 0.75
18 0.76
19 0.83
20 0.88
21 0.89
22 0.84
23 0.8
24 0.81
25 0.82
26 0.75
27 0.7
28 0.69
29 0.65
30 0.68
31 0.65
32 0.58
33 0.5
34 0.47
35 0.49
36 0.43
37 0.37
38 0.29
39 0.27
40 0.3
41 0.3
42 0.34
43 0.29
44 0.28
45 0.34
46 0.36
47 0.37
48 0.42
49 0.49
50 0.53
51 0.6
52 0.64
53 0.64
54 0.63
55 0.6
56 0.5
57 0.44
58 0.36
59 0.27
60 0.2
61 0.13
62 0.11
63 0.1
64 0.1
65 0.05
66 0.06
67 0.1
68 0.13
69 0.13
70 0.14
71 0.18
72 0.2
73 0.24
74 0.25
75 0.23
76 0.29
77 0.35
78 0.42
79 0.44
80 0.45
81 0.43
82 0.45
83 0.43
84 0.36
85 0.3
86 0.24
87 0.17
88 0.16
89 0.14
90 0.09
91 0.1
92 0.09
93 0.09
94 0.08
95 0.09
96 0.1
97 0.1
98 0.12
99 0.12
100 0.11
101 0.18
102 0.22
103 0.29
104 0.3
105 0.33
106 0.32
107 0.37
108 0.39
109 0.35
110 0.36
111 0.31
112 0.35
113 0.34
114 0.36
115 0.32
116 0.31
117 0.3
118 0.25
119 0.22
120 0.17
121 0.15
122 0.21
123 0.22
124 0.25
125 0.24
126 0.26
127 0.26
128 0.27