Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A874

Protein Details
Accession A0A545A874   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
130-149SMAQLSKKRRPIQFDKRLLVHydrophilic
NLS Segment(s)
Subcellular Location(s) golg 2, mito 14, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences MPTSETSKISLITTPLFWQKLQAFYTLMRPIHESQKMSESNRATSAHVYPRWIGFNTHFQNNRAIGPFTADINAYLNRVERGGWSNRIKKQLLPIHTAAYIFTPLNHAAEIMPASLQALEANAWQICLDSMAQLSKKRRPIQFDKRLLVVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.25
4 0.24
5 0.28
6 0.28
7 0.32
8 0.31
9 0.3
10 0.26
11 0.25
12 0.32
13 0.32
14 0.29
15 0.25
16 0.28
17 0.29
18 0.35
19 0.39
20 0.34
21 0.3
22 0.37
23 0.4
24 0.39
25 0.42
26 0.36
27 0.34
28 0.36
29 0.35
30 0.29
31 0.27
32 0.28
33 0.29
34 0.28
35 0.28
36 0.25
37 0.26
38 0.27
39 0.25
40 0.23
41 0.19
42 0.27
43 0.28
44 0.34
45 0.34
46 0.33
47 0.36
48 0.35
49 0.34
50 0.26
51 0.24
52 0.17
53 0.18
54 0.17
55 0.13
56 0.12
57 0.1
58 0.09
59 0.1
60 0.1
61 0.08
62 0.08
63 0.08
64 0.07
65 0.08
66 0.07
67 0.07
68 0.11
69 0.14
70 0.21
71 0.27
72 0.33
73 0.38
74 0.44
75 0.43
76 0.41
77 0.47
78 0.46
79 0.43
80 0.41
81 0.38
82 0.34
83 0.34
84 0.32
85 0.23
86 0.18
87 0.16
88 0.11
89 0.09
90 0.1
91 0.1
92 0.11
93 0.1
94 0.1
95 0.08
96 0.09
97 0.1
98 0.07
99 0.06
100 0.05
101 0.06
102 0.06
103 0.06
104 0.04
105 0.05
106 0.05
107 0.05
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.08
116 0.06
117 0.08
118 0.12
119 0.15
120 0.22
121 0.28
122 0.35
123 0.44
124 0.51
125 0.56
126 0.61
127 0.69
128 0.74
129 0.78
130 0.81
131 0.76
132 0.74