Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VQL9

Protein Details
Accession H1VQL9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
140-163TSADSTPKKRRTPAKKSAPKVENDHydrophilic
NLS Segment(s)
PositionSequence
90-104PKAKSPRKKAAPKQK
128-158KKKATPKKRAAATSADSTPKKRRTPAKKSAP
Subcellular Location(s) nucl 16.5, cyto_nucl 11, pero 5, cyto 4.5
Family & Domain DBs
KEGG chig:CH63R_04704  -  
Amino Acid Sequences MADPKDNASSSANASEKAPAGGRVGAWTDAERYQLLLRVLAVLLPDGKGVDWKNINMPNRTLKAIQGQWTSIVVQMRELGMEGEGNTAAPKAKSPRKKAAPKQKATAAGDGQNANEDTGDDQDDEETKKKATPKKRAAATSADSTPKKRRTPAKKSAPKVENDAESDNEAAVPKKEDENGDDDLAGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.23
4 0.23
5 0.21
6 0.16
7 0.17
8 0.17
9 0.16
10 0.16
11 0.17
12 0.16
13 0.15
14 0.15
15 0.15
16 0.15
17 0.16
18 0.14
19 0.14
20 0.14
21 0.17
22 0.17
23 0.15
24 0.14
25 0.13
26 0.13
27 0.12
28 0.11
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.09
36 0.1
37 0.15
38 0.16
39 0.17
40 0.23
41 0.29
42 0.33
43 0.32
44 0.35
45 0.36
46 0.37
47 0.38
48 0.33
49 0.29
50 0.31
51 0.31
52 0.33
53 0.28
54 0.26
55 0.24
56 0.24
57 0.23
58 0.18
59 0.17
60 0.11
61 0.1
62 0.11
63 0.1
64 0.09
65 0.09
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.07
78 0.12
79 0.2
80 0.29
81 0.35
82 0.45
83 0.54
84 0.64
85 0.71
86 0.77
87 0.8
88 0.76
89 0.74
90 0.7
91 0.67
92 0.59
93 0.53
94 0.43
95 0.35
96 0.33
97 0.29
98 0.24
99 0.18
100 0.16
101 0.13
102 0.11
103 0.08
104 0.06
105 0.07
106 0.08
107 0.06
108 0.06
109 0.07
110 0.08
111 0.1
112 0.12
113 0.12
114 0.12
115 0.15
116 0.21
117 0.29
118 0.38
119 0.47
120 0.55
121 0.63
122 0.69
123 0.7
124 0.67
125 0.65
126 0.59
127 0.53
128 0.47
129 0.45
130 0.4
131 0.41
132 0.47
133 0.49
134 0.5
135 0.53
136 0.59
137 0.64
138 0.73
139 0.78
140 0.8
141 0.82
142 0.85
143 0.87
144 0.83
145 0.75
146 0.72
147 0.67
148 0.6
149 0.53
150 0.49
151 0.4
152 0.35
153 0.32
154 0.25
155 0.2
156 0.17
157 0.15
158 0.14
159 0.15
160 0.15
161 0.18
162 0.21
163 0.23
164 0.25
165 0.28
166 0.3
167 0.28
168 0.26