Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A7T2

Protein Details
Accession A0A545A7T2   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29RAQDNTIKLKCKKKPENPIVEAIKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 5.5, mito 12, nucl 8.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR030382  MeTrfase_TRM5/TYW2  
IPR029063  SAM-dependent_MTases_sf  
IPR026274  tRNA_wybutosine_synth_prot_2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0008757  F:S-adenosylmethionine-dependent methyltransferase activity  
GO:0031591  P:wybutosine biosynthetic process  
Pfam View protein in Pfam  
PF02475  Met_10  
PROSITE View protein in PROSITE  
PS51684  SAM_MT_TRM5_TYW2  
Amino Acid Sequences MNHTLRAQDNTIKLKCKKKPENPIVEAIKIWVESLPAEFLASLKLSVPQLLDSSFDSEWNSIFQPFDVFSSSHDYRSDLSMLILSNIARKEGKKALTHLAVNSGIPRYGPVLDGKESKENVLRTPSGLIPLYGDFGPALSPTAIPCQQDFDDALWVSTKQNGITQIWAPRYTMFSRGNFKEKQRLLKFHSQDFLKEVDLGSTLALDLYAGIGYFVFSYVKMGIGKVLCWEINPWSLEGLRRGAVANKWSIKFINSGDQSLSASEKIIVFPEDNRLANEKLMKSPVLGAIKHVNCGLLPTSVKSWKTAVQNVASGGWLHLHENVDKKDISLRRAKIEETCQQWLDETGGRAQVIHVELVKTFAPQIWHCVFDVYILRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.73
4 0.77
5 0.78
6 0.84
7 0.86
8 0.89
9 0.84
10 0.85
11 0.79
12 0.69
13 0.59
14 0.49
15 0.4
16 0.29
17 0.25
18 0.16
19 0.12
20 0.11
21 0.12
22 0.12
23 0.1
24 0.1
25 0.09
26 0.09
27 0.1
28 0.1
29 0.09
30 0.08
31 0.11
32 0.12
33 0.13
34 0.14
35 0.13
36 0.14
37 0.14
38 0.15
39 0.13
40 0.17
41 0.15
42 0.16
43 0.16
44 0.15
45 0.15
46 0.16
47 0.15
48 0.12
49 0.13
50 0.12
51 0.12
52 0.12
53 0.13
54 0.13
55 0.12
56 0.13
57 0.21
58 0.22
59 0.23
60 0.23
61 0.23
62 0.22
63 0.24
64 0.24
65 0.15
66 0.15
67 0.14
68 0.14
69 0.13
70 0.13
71 0.1
72 0.13
73 0.13
74 0.14
75 0.15
76 0.15
77 0.21
78 0.26
79 0.32
80 0.31
81 0.35
82 0.4
83 0.43
84 0.44
85 0.38
86 0.36
87 0.31
88 0.28
89 0.26
90 0.19
91 0.14
92 0.12
93 0.12
94 0.1
95 0.1
96 0.11
97 0.12
98 0.14
99 0.17
100 0.2
101 0.22
102 0.25
103 0.25
104 0.26
105 0.28
106 0.26
107 0.26
108 0.28
109 0.26
110 0.21
111 0.23
112 0.22
113 0.2
114 0.19
115 0.17
116 0.13
117 0.13
118 0.14
119 0.11
120 0.11
121 0.07
122 0.07
123 0.07
124 0.06
125 0.07
126 0.05
127 0.05
128 0.06
129 0.1
130 0.12
131 0.13
132 0.13
133 0.16
134 0.15
135 0.17
136 0.17
137 0.14
138 0.15
139 0.14
140 0.14
141 0.11
142 0.11
143 0.1
144 0.12
145 0.12
146 0.09
147 0.11
148 0.13
149 0.13
150 0.15
151 0.17
152 0.19
153 0.21
154 0.21
155 0.19
156 0.18
157 0.2
158 0.19
159 0.23
160 0.22
161 0.23
162 0.29
163 0.32
164 0.37
165 0.37
166 0.39
167 0.41
168 0.41
169 0.48
170 0.47
171 0.5
172 0.5
173 0.56
174 0.56
175 0.49
176 0.51
177 0.41
178 0.37
179 0.33
180 0.28
181 0.19
182 0.17
183 0.14
184 0.09
185 0.09
186 0.09
187 0.06
188 0.05
189 0.04
190 0.04
191 0.04
192 0.03
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.05
205 0.05
206 0.07
207 0.07
208 0.07
209 0.09
210 0.09
211 0.09
212 0.09
213 0.11
214 0.09
215 0.09
216 0.1
217 0.1
218 0.13
219 0.14
220 0.13
221 0.12
222 0.13
223 0.14
224 0.15
225 0.15
226 0.12
227 0.12
228 0.12
229 0.14
230 0.16
231 0.17
232 0.2
233 0.24
234 0.24
235 0.25
236 0.25
237 0.23
238 0.24
239 0.23
240 0.26
241 0.22
242 0.23
243 0.22
244 0.22
245 0.21
246 0.19
247 0.19
248 0.1
249 0.09
250 0.09
251 0.09
252 0.09
253 0.1
254 0.1
255 0.1
256 0.1
257 0.16
258 0.19
259 0.19
260 0.2
261 0.23
262 0.23
263 0.24
264 0.29
265 0.25
266 0.24
267 0.26
268 0.24
269 0.21
270 0.22
271 0.25
272 0.24
273 0.22
274 0.22
275 0.29
276 0.29
277 0.3
278 0.28
279 0.23
280 0.19
281 0.21
282 0.19
283 0.13
284 0.14
285 0.14
286 0.19
287 0.24
288 0.25
289 0.25
290 0.26
291 0.29
292 0.34
293 0.38
294 0.39
295 0.36
296 0.38
297 0.37
298 0.35
299 0.29
300 0.23
301 0.17
302 0.14
303 0.12
304 0.11
305 0.13
306 0.14
307 0.17
308 0.24
309 0.25
310 0.27
311 0.26
312 0.26
313 0.32
314 0.34
315 0.37
316 0.39
317 0.41
318 0.45
319 0.48
320 0.49
321 0.47
322 0.51
323 0.52
324 0.49
325 0.51
326 0.44
327 0.42
328 0.41
329 0.35
330 0.31
331 0.27
332 0.23
333 0.2
334 0.21
335 0.21
336 0.2
337 0.19
338 0.2
339 0.18
340 0.18
341 0.17
342 0.15
343 0.16
344 0.18
345 0.18
346 0.14
347 0.14
348 0.14
349 0.18
350 0.18
351 0.26
352 0.26
353 0.28
354 0.27
355 0.28
356 0.26
357 0.24