Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A6Q5

Protein Details
Accession A0A545A6Q5    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGLVQFPSISVQELQPIIHGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.83
4 0.88
5 0.87
6 0.88
7 0.88
8 0.88
9 0.86
10 0.86
11 0.89
12 0.82
13 0.81
14 0.75
15 0.71
16 0.63
17 0.57
18 0.47
19 0.38
20 0.36
21 0.36
22 0.34
23 0.31
24 0.36
25 0.39
26 0.44
27 0.5
28 0.54
29 0.51
30 0.57
31 0.65
32 0.62
33 0.64
34 0.62
35 0.61
36 0.6
37 0.62
38 0.53
39 0.48
40 0.44
41 0.36
42 0.38
43 0.39
44 0.37
45 0.31
46 0.38
47 0.41
48 0.49
49 0.57
50 0.59
51 0.58
52 0.61
53 0.68
54 0.69
55 0.67
56 0.62
57 0.57
58 0.54
59 0.52
60 0.47
61 0.42
62 0.39
63 0.33
64 0.28
65 0.26
66 0.26
67 0.3
68 0.36
69 0.38
70 0.42
71 0.51
72 0.58
73 0.62
74 0.6
75 0.54
76 0.5
77 0.44
78 0.41
79 0.39
80 0.36
81 0.37
82 0.36
83 0.33
84 0.3
85 0.29
86 0.26
87 0.18
88 0.15
89 0.09
90 0.09
91 0.12
92 0.13
93 0.13
94 0.13
95 0.16
96 0.17
97 0.21
98 0.23
99 0.23
100 0.28
101 0.33
102 0.34
103 0.32