Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A3L9

Protein Details
Accession A0A545A3L9   
Localization Confidence High
Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-45QIYGNGSKPSKKPRRQEITQSQKQHSHydrophilic
107-127VKFFERQKASRKVKKIRKLILHydrophilic
241-270HDGIKHKESKDSKKKVRNKGNSTPKNGLRDBasic
NLS Segment(s)
PositionSequence
95-124KRRQRMIKKYHMVKFFERQKASRKVKKIRK
245-260KHKESKDSKKKVRNKG
Subcellular Location(s) cyto_nucl 15, nucl 24.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MSSKRKHDEIYGVHESRHAQIYGNGSKPSKKPRRQEITQSQKQHSPSSINAIKKRLRDVNRRLERSDKISAEIRVQDERARETYQQELAAAEAEKRRQRMIKKYHMVKFFERQKASRKVKKIRKLILSADSTEAVQNLNKQLHEAEVDLNYTLYHPLGEVYISLYPKKISSEKEDDDQNAATKKPTVWYEIEEAMVNGTLERIRNRVSLKPVNPSKVFNKKQASKKSEEISSHTNSTEDRHDGIKHKESKDSKKKVRNKGNSTPKNGLRDEPQTVSDVEESDGGFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.38
4 0.37
5 0.29
6 0.2
7 0.23
8 0.31
9 0.35
10 0.37
11 0.38
12 0.36
13 0.42
14 0.47
15 0.54
16 0.57
17 0.6
18 0.66
19 0.73
20 0.8
21 0.82
22 0.87
23 0.87
24 0.87
25 0.87
26 0.84
27 0.77
28 0.73
29 0.68
30 0.61
31 0.54
32 0.47
33 0.4
34 0.42
35 0.44
36 0.46
37 0.48
38 0.52
39 0.53
40 0.52
41 0.57
42 0.57
43 0.6
44 0.63
45 0.68
46 0.71
47 0.77
48 0.78
49 0.73
50 0.71
51 0.66
52 0.62
53 0.59
54 0.49
55 0.42
56 0.42
57 0.4
58 0.37
59 0.36
60 0.33
61 0.27
62 0.27
63 0.27
64 0.24
65 0.26
66 0.26
67 0.25
68 0.24
69 0.24
70 0.27
71 0.27
72 0.25
73 0.21
74 0.18
75 0.15
76 0.15
77 0.13
78 0.11
79 0.12
80 0.17
81 0.19
82 0.21
83 0.24
84 0.28
85 0.35
86 0.43
87 0.5
88 0.56
89 0.62
90 0.7
91 0.73
92 0.74
93 0.71
94 0.65
95 0.64
96 0.63
97 0.61
98 0.55
99 0.52
100 0.54
101 0.6
102 0.66
103 0.64
104 0.65
105 0.67
106 0.74
107 0.8
108 0.81
109 0.78
110 0.75
111 0.72
112 0.66
113 0.62
114 0.54
115 0.46
116 0.38
117 0.31
118 0.24
119 0.2
120 0.16
121 0.1
122 0.08
123 0.08
124 0.1
125 0.11
126 0.11
127 0.11
128 0.11
129 0.11
130 0.11
131 0.1
132 0.09
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.06
139 0.06
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.07
149 0.08
150 0.09
151 0.09
152 0.09
153 0.1
154 0.13
155 0.15
156 0.16
157 0.22
158 0.3
159 0.31
160 0.34
161 0.36
162 0.34
163 0.32
164 0.3
165 0.25
166 0.19
167 0.17
168 0.15
169 0.14
170 0.14
171 0.15
172 0.16
173 0.18
174 0.18
175 0.2
176 0.23
177 0.22
178 0.22
179 0.19
180 0.17
181 0.13
182 0.12
183 0.09
184 0.06
185 0.06
186 0.06
187 0.08
188 0.09
189 0.11
190 0.13
191 0.17
192 0.21
193 0.25
194 0.32
195 0.39
196 0.41
197 0.49
198 0.52
199 0.55
200 0.54
201 0.54
202 0.54
203 0.57
204 0.58
205 0.57
206 0.61
207 0.63
208 0.7
209 0.76
210 0.74
211 0.7
212 0.73
213 0.69
214 0.66
215 0.6
216 0.55
217 0.51
218 0.49
219 0.44
220 0.37
221 0.33
222 0.27
223 0.28
224 0.27
225 0.23
226 0.21
227 0.22
228 0.26
229 0.31
230 0.38
231 0.44
232 0.47
233 0.47
234 0.54
235 0.6
236 0.67
237 0.72
238 0.76
239 0.77
240 0.8
241 0.87
242 0.89
243 0.91
244 0.91
245 0.9
246 0.9
247 0.91
248 0.89
249 0.88
250 0.86
251 0.81
252 0.78
253 0.71
254 0.64
255 0.59
256 0.56
257 0.54
258 0.47
259 0.42
260 0.37
261 0.35
262 0.34
263 0.28
264 0.23
265 0.18
266 0.16
267 0.15