Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZR17

Protein Details
Accession A0A544ZR17   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-110VKTTEKKATKGTKGTKGKKKAAAHydrophilic
NLS Segment(s)
PositionSequence
91-110TEKKATKGTKGTKGKKKAAA
Subcellular Location(s) cyto 5.5, cyto_nucl 5.333, mito 17.5, mito_nucl 11.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007653  SPC3  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF04573  SPC22  
Amino Acid Sequences MKKLKRSAEGKSIDPSRGMLKLKNQKPKYQITHPTGKIAETDNVTLRLHYNVQPWVGMLTWNMDKDIGFWKSMEGGESEAKTLPALKVKTTEKKATKGTKGTKGKKKAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.31
4 0.32
5 0.31
6 0.27
7 0.33
8 0.42
9 0.49
10 0.58
11 0.59
12 0.61
13 0.65
14 0.71
15 0.68
16 0.67
17 0.69
18 0.65
19 0.7
20 0.64
21 0.63
22 0.53
23 0.46
24 0.38
25 0.31
26 0.27
27 0.19
28 0.19
29 0.16
30 0.17
31 0.17
32 0.16
33 0.14
34 0.13
35 0.14
36 0.14
37 0.15
38 0.15
39 0.15
40 0.15
41 0.14
42 0.13
43 0.11
44 0.09
45 0.06
46 0.07
47 0.08
48 0.09
49 0.09
50 0.08
51 0.08
52 0.09
53 0.14
54 0.13
55 0.12
56 0.12
57 0.12
58 0.14
59 0.14
60 0.14
61 0.09
62 0.1
63 0.12
64 0.12
65 0.13
66 0.12
67 0.12
68 0.11
69 0.12
70 0.12
71 0.16
72 0.17
73 0.17
74 0.24
75 0.31
76 0.4
77 0.45
78 0.53
79 0.52
80 0.58
81 0.66
82 0.69
83 0.7
84 0.7
85 0.72
86 0.73
87 0.78
88 0.82
89 0.83
90 0.83