Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VUM4

Protein Details
Accession H1VUM4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
143-164EIQFGHKKRPKRVRGEEVDTKGBasic
NLS Segment(s)
PositionSequence
149-154KKRPKR
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003837  Asp/Glu-ADT_csu  
Gene Ontology GO:0006450  P:regulation of translational fidelity  
KEGG chig:CH63R_10100  -  
Pfam View protein in Pfam  
PF02686  Glu-tRNAGln  
Amino Acid Sequences MHPVCRRCSALLFQQTRTFASSSVNLSVPKPASAFLSKPTWSVASLLPPSTKAGASETSPEEPISRAKLHHLLRLSALPLPDTEAAESAMLRTLHSQLHFVRDVQSVETTGVEPLRSLRDETTEGVAEVTIGLEELQDALGNEIQFGHKKRPKRVRGEEVDTKGAEDWDPLKTASRTAGKYFVVQSKKEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.47
4 0.44
5 0.35
6 0.25
7 0.25
8 0.25
9 0.22
10 0.23
11 0.24
12 0.22
13 0.22
14 0.27
15 0.24
16 0.22
17 0.2
18 0.17
19 0.2
20 0.22
21 0.23
22 0.21
23 0.25
24 0.25
25 0.25
26 0.26
27 0.23
28 0.2
29 0.21
30 0.18
31 0.19
32 0.2
33 0.21
34 0.19
35 0.19
36 0.2
37 0.19
38 0.18
39 0.13
40 0.13
41 0.14
42 0.14
43 0.17
44 0.18
45 0.18
46 0.19
47 0.18
48 0.16
49 0.16
50 0.17
51 0.17
52 0.16
53 0.15
54 0.18
55 0.25
56 0.26
57 0.3
58 0.29
59 0.26
60 0.26
61 0.27
62 0.24
63 0.18
64 0.16
65 0.12
66 0.1
67 0.12
68 0.11
69 0.1
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.05
76 0.08
77 0.07
78 0.07
79 0.08
80 0.09
81 0.1
82 0.11
83 0.14
84 0.11
85 0.15
86 0.16
87 0.15
88 0.16
89 0.17
90 0.17
91 0.15
92 0.15
93 0.11
94 0.11
95 0.11
96 0.09
97 0.08
98 0.08
99 0.06
100 0.06
101 0.07
102 0.09
103 0.09
104 0.1
105 0.1
106 0.13
107 0.15
108 0.16
109 0.17
110 0.15
111 0.14
112 0.13
113 0.12
114 0.09
115 0.07
116 0.06
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.05
127 0.07
128 0.07
129 0.07
130 0.07
131 0.09
132 0.14
133 0.16
134 0.26
135 0.29
136 0.36
137 0.47
138 0.57
139 0.65
140 0.72
141 0.79
142 0.8
143 0.84
144 0.85
145 0.84
146 0.78
147 0.73
148 0.62
149 0.53
150 0.43
151 0.35
152 0.26
153 0.19
154 0.16
155 0.13
156 0.14
157 0.14
158 0.19
159 0.18
160 0.2
161 0.25
162 0.3
163 0.32
164 0.34
165 0.39
166 0.35
167 0.38
168 0.42
169 0.43
170 0.42
171 0.41