Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A0R7

Protein Details
Accession A0A545A0R7   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
75-105FLKCEKENHRIHKNCKNCKHRVCKNCIKGTLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 4.833, mito 16.5, mito_nucl 12.333, nucl 7
Family & Domain DBs
Amino Acid Sequences PTPHKGIVKKTKRYAVFLMDHVKRGEVPWTQWYCCHVVNGFELPSLVSFSLYRLMVEENNASFPLYTSADVTSVFLKCEKENHRIHKNCKNCKHRVCKNCIKGTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.57
4 0.52
5 0.53
6 0.46
7 0.45
8 0.4
9 0.36
10 0.29
11 0.26
12 0.26
13 0.19
14 0.2
15 0.27
16 0.3
17 0.3
18 0.31
19 0.33
20 0.31
21 0.29
22 0.28
23 0.19
24 0.17
25 0.18
26 0.19
27 0.16
28 0.13
29 0.12
30 0.1
31 0.1
32 0.09
33 0.07
34 0.06
35 0.05
36 0.06
37 0.09
38 0.08
39 0.08
40 0.08
41 0.09
42 0.08
43 0.1
44 0.1
45 0.08
46 0.09
47 0.09
48 0.08
49 0.07
50 0.07
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.1
62 0.11
63 0.12
64 0.13
65 0.21
66 0.25
67 0.32
68 0.4
69 0.48
70 0.57
71 0.64
72 0.72
73 0.74
74 0.79
75 0.81
76 0.83
77 0.84
78 0.84
79 0.86
80 0.88
81 0.89
82 0.89
83 0.88
84 0.89
85 0.89