Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A9S7

Protein Details
Accession A0A545A9S7    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
56-81GETPKSSRKASYNKKRLRSDPQDGKEHydrophilic
237-266IAAKKLASKMKNRQRQKKRRIQLNRQETTNHydrophilic
NLS Segment(s)
PositionSequence
239-256AKKLASKMKNRQRQKKRR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013268  U3_snoRNA_assoc  
Gene Ontology GO:0030515  F:snoRNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF08297  U3_snoRNA_assoc  
Amino Acid Sequences MSTLFRLYNSAKSLLSNNPKHEKRIDTLETNIEDIGIKTGIQTSNRLREMGEDSNGETPKSSRKASYNKKRLRSDPQDGKEMVTLSSSKKQKNLPLREKHIDNVQTPKSRLAVEIMVKSSQSGTERFVTPMKDFGHCERNGSTIKRFSRTSAAKKDFLNDISIENKKTPDSRAHHRRFGSEESETQTFATPMEQIPTIIQPSQQEVIESDDDAPEAVTIHQSEPIDELKIDDSARSIAAKKLASKMKNRQRQKKRRIQLNRQETTNSNPTYDSADSIVDEETTQEKNSTNLKEFPQNSSKISLDSKNRLPDLLPLDYLEDVEPLEVSNPSHELHARKMGNKIKFSDLVEKKVKDKRVGSTTFRVVKASNRSLAPKAVLNARRTKELWLQGRSGQRQESRRISFSRKFTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.46
4 0.5
5 0.58
6 0.61
7 0.64
8 0.67
9 0.63
10 0.58
11 0.61
12 0.59
13 0.53
14 0.53
15 0.54
16 0.49
17 0.44
18 0.39
19 0.29
20 0.23
21 0.19
22 0.18
23 0.11
24 0.09
25 0.09
26 0.14
27 0.17
28 0.18
29 0.24
30 0.29
31 0.38
32 0.4
33 0.4
34 0.35
35 0.36
36 0.41
37 0.38
38 0.34
39 0.26
40 0.27
41 0.33
42 0.33
43 0.29
44 0.23
45 0.21
46 0.27
47 0.3
48 0.31
49 0.3
50 0.38
51 0.49
52 0.59
53 0.69
54 0.71
55 0.75
56 0.82
57 0.85
58 0.84
59 0.85
60 0.83
61 0.82
62 0.82
63 0.77
64 0.75
65 0.67
66 0.61
67 0.53
68 0.44
69 0.33
70 0.24
71 0.22
72 0.18
73 0.26
74 0.31
75 0.31
76 0.36
77 0.42
78 0.48
79 0.57
80 0.64
81 0.66
82 0.69
83 0.75
84 0.77
85 0.74
86 0.68
87 0.65
88 0.59
89 0.52
90 0.5
91 0.49
92 0.47
93 0.46
94 0.46
95 0.4
96 0.35
97 0.33
98 0.28
99 0.25
100 0.23
101 0.25
102 0.24
103 0.23
104 0.22
105 0.22
106 0.19
107 0.16
108 0.15
109 0.13
110 0.14
111 0.17
112 0.19
113 0.2
114 0.22
115 0.22
116 0.21
117 0.25
118 0.24
119 0.23
120 0.24
121 0.27
122 0.33
123 0.31
124 0.33
125 0.28
126 0.3
127 0.32
128 0.33
129 0.33
130 0.33
131 0.36
132 0.37
133 0.37
134 0.35
135 0.4
136 0.45
137 0.49
138 0.52
139 0.53
140 0.53
141 0.53
142 0.53
143 0.47
144 0.4
145 0.33
146 0.23
147 0.2
148 0.21
149 0.23
150 0.21
151 0.19
152 0.19
153 0.18
154 0.2
155 0.21
156 0.25
157 0.28
158 0.38
159 0.48
160 0.53
161 0.58
162 0.57
163 0.57
164 0.52
165 0.51
166 0.44
167 0.36
168 0.32
169 0.28
170 0.28
171 0.25
172 0.22
173 0.18
174 0.14
175 0.11
176 0.1
177 0.07
178 0.06
179 0.08
180 0.07
181 0.07
182 0.08
183 0.08
184 0.09
185 0.08
186 0.09
187 0.09
188 0.11
189 0.12
190 0.11
191 0.1
192 0.1
193 0.13
194 0.12
195 0.11
196 0.1
197 0.08
198 0.08
199 0.08
200 0.07
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.06
207 0.09
208 0.09
209 0.09
210 0.1
211 0.11
212 0.11
213 0.1
214 0.1
215 0.08
216 0.1
217 0.09
218 0.08
219 0.08
220 0.07
221 0.08
222 0.08
223 0.09
224 0.09
225 0.13
226 0.14
227 0.16
228 0.22
229 0.28
230 0.32
231 0.4
232 0.49
233 0.55
234 0.63
235 0.71
236 0.75
237 0.8
238 0.86
239 0.89
240 0.9
241 0.89
242 0.9
243 0.91
244 0.91
245 0.9
246 0.9
247 0.83
248 0.74
249 0.68
250 0.58
251 0.54
252 0.5
253 0.41
254 0.3
255 0.27
256 0.26
257 0.27
258 0.26
259 0.21
260 0.14
261 0.13
262 0.13
263 0.13
264 0.12
265 0.08
266 0.08
267 0.08
268 0.09
269 0.1
270 0.1
271 0.1
272 0.11
273 0.14
274 0.2
275 0.23
276 0.24
277 0.28
278 0.3
279 0.37
280 0.39
281 0.42
282 0.43
283 0.42
284 0.4
285 0.39
286 0.37
287 0.32
288 0.34
289 0.34
290 0.34
291 0.38
292 0.42
293 0.44
294 0.44
295 0.42
296 0.38
297 0.38
298 0.36
299 0.32
300 0.26
301 0.21
302 0.22
303 0.21
304 0.21
305 0.15
306 0.1
307 0.08
308 0.07
309 0.07
310 0.05
311 0.07
312 0.07
313 0.07
314 0.08
315 0.1
316 0.1
317 0.12
318 0.16
319 0.18
320 0.21
321 0.3
322 0.32
323 0.34
324 0.43
325 0.48
326 0.52
327 0.54
328 0.53
329 0.5
330 0.51
331 0.51
332 0.53
333 0.5
334 0.51
335 0.54
336 0.53
337 0.55
338 0.58
339 0.61
340 0.58
341 0.59
342 0.59
343 0.61
344 0.65
345 0.64
346 0.65
347 0.67
348 0.65
349 0.61
350 0.55
351 0.46
352 0.47
353 0.5
354 0.49
355 0.45
356 0.42
357 0.45
358 0.46
359 0.48
360 0.43
361 0.37
362 0.35
363 0.39
364 0.42
365 0.44
366 0.5
367 0.49
368 0.53
369 0.5
370 0.53
371 0.52
372 0.55
373 0.57
374 0.53
375 0.54
376 0.54
377 0.62
378 0.62
379 0.59
380 0.57
381 0.57
382 0.59
383 0.65
384 0.68
385 0.65
386 0.66
387 0.67
388 0.69
389 0.69
390 0.72