Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A703

Protein Details
Accession A0A545A703   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-33PENFTFKTFKKLKNDRPESSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 5.5, cyto_mito 5.833, mito 5, mito_nucl 11.333, nucl 16.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004276  GlycoTrans_28_N  
Gene Ontology GO:0016758  F:hexosyltransferase activity  
GO:0005975  P:carbohydrate metabolic process  
GO:0030259  P:lipid glycosylation  
Pfam View protein in Pfam  
PF03033  Glyco_transf_28  
Amino Acid Sequences MATSISVPSRVDPPENFTFKTFKKLKNDRPESSLNTSRRPKILRWLSKSSSATVESPIQISSDQKRNVQDTHHSKEVGLKDHDRVSNLNPSPTSDSDENVPTCNKKRDGVSNINMLSKSDPADNDYQTKSKVLKKDGRLDIGAKEMKNRGYLAKAIGTSFLKHIKPSTKSDDPRNTNNDDSKRSRIFFNTAFSSKTLPPTLNIVLMVIGSRGDIQPFLKIGKSLKDYGHRVRIATHPAFKKIVQEDMDLEFFSVGGDPAELMAFMVKNPGMIPTIETLKKGEISRRRKQMAEMFEDSFIIYKSEDIPEHIKQSFVLPSNLIRNLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.43
4 0.4
5 0.44
6 0.41
7 0.5
8 0.5
9 0.49
10 0.56
11 0.65
12 0.72
13 0.77
14 0.85
15 0.79
16 0.77
17 0.77
18 0.72
19 0.7
20 0.69
21 0.61
22 0.61
23 0.64
24 0.63
25 0.63
26 0.61
27 0.55
28 0.57
29 0.64
30 0.65
31 0.65
32 0.69
33 0.65
34 0.7
35 0.68
36 0.59
37 0.52
38 0.45
39 0.38
40 0.33
41 0.32
42 0.24
43 0.23
44 0.21
45 0.18
46 0.16
47 0.19
48 0.22
49 0.28
50 0.3
51 0.33
52 0.38
53 0.41
54 0.42
55 0.42
56 0.46
57 0.46
58 0.5
59 0.5
60 0.46
61 0.42
62 0.47
63 0.47
64 0.43
65 0.39
66 0.35
67 0.34
68 0.39
69 0.41
70 0.35
71 0.33
72 0.3
73 0.35
74 0.34
75 0.33
76 0.28
77 0.29
78 0.32
79 0.31
80 0.33
81 0.24
82 0.24
83 0.23
84 0.27
85 0.25
86 0.22
87 0.23
88 0.22
89 0.27
90 0.33
91 0.32
92 0.31
93 0.35
94 0.41
95 0.47
96 0.51
97 0.49
98 0.49
99 0.48
100 0.47
101 0.43
102 0.35
103 0.28
104 0.21
105 0.18
106 0.13
107 0.12
108 0.13
109 0.17
110 0.18
111 0.2
112 0.21
113 0.22
114 0.21
115 0.23
116 0.24
117 0.26
118 0.3
119 0.34
120 0.4
121 0.45
122 0.54
123 0.55
124 0.54
125 0.5
126 0.46
127 0.38
128 0.37
129 0.34
130 0.24
131 0.23
132 0.22
133 0.22
134 0.22
135 0.22
136 0.17
137 0.16
138 0.17
139 0.15
140 0.15
141 0.14
142 0.13
143 0.14
144 0.14
145 0.13
146 0.13
147 0.17
148 0.15
149 0.15
150 0.18
151 0.22
152 0.25
153 0.29
154 0.35
155 0.38
156 0.42
157 0.5
158 0.57
159 0.56
160 0.58
161 0.58
162 0.54
163 0.49
164 0.52
165 0.47
166 0.44
167 0.43
168 0.43
169 0.42
170 0.4
171 0.38
172 0.34
173 0.35
174 0.31
175 0.31
176 0.29
177 0.27
178 0.26
179 0.25
180 0.26
181 0.23
182 0.24
183 0.21
184 0.17
185 0.17
186 0.2
187 0.2
188 0.17
189 0.16
190 0.13
191 0.11
192 0.1
193 0.1
194 0.05
195 0.04
196 0.04
197 0.05
198 0.05
199 0.05
200 0.06
201 0.07
202 0.08
203 0.09
204 0.1
205 0.1
206 0.12
207 0.13
208 0.18
209 0.21
210 0.23
211 0.26
212 0.33
213 0.38
214 0.43
215 0.5
216 0.45
217 0.42
218 0.42
219 0.42
220 0.43
221 0.41
222 0.43
223 0.37
224 0.39
225 0.41
226 0.39
227 0.41
228 0.35
229 0.37
230 0.31
231 0.29
232 0.28
233 0.29
234 0.29
235 0.22
236 0.2
237 0.14
238 0.11
239 0.1
240 0.08
241 0.05
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.04
249 0.05
250 0.05
251 0.05
252 0.08
253 0.07
254 0.08
255 0.08
256 0.1
257 0.1
258 0.1
259 0.12
260 0.12
261 0.19
262 0.19
263 0.2
264 0.2
265 0.21
266 0.26
267 0.27
268 0.33
269 0.37
270 0.45
271 0.54
272 0.63
273 0.66
274 0.63
275 0.68
276 0.67
277 0.65
278 0.64
279 0.59
280 0.51
281 0.46
282 0.45
283 0.37
284 0.3
285 0.22
286 0.15
287 0.1
288 0.09
289 0.11
290 0.15
291 0.15
292 0.19
293 0.24
294 0.27
295 0.33
296 0.32
297 0.3
298 0.26
299 0.3
300 0.32
301 0.29
302 0.28
303 0.24
304 0.29
305 0.35