Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545ABH2

Protein Details
Accession A0A545ABH2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-89LGAYAVRKKIKKNRKMKKLKKDVKKLKKAQGIDBasic
NLS Segment(s)
PositionSequence
63-85RKKIKKNRKMKKLKKDVKKLKKA
Subcellular Location(s) E.R. 3, cyto_mito 4, extr 4, mito 7, plas 9
Family & Domain DBs
Amino Acid Sequences MLSPRVILRVALVAFFSLPLIGETYGAVIREDTTMLTARTTNLEPRGTKTKIAVLSLGAYAVRKKIKKNRKMKKLKKDVKKLKKAQGID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.05
5 0.05
6 0.05
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.08
13 0.08
14 0.08
15 0.06
16 0.07
17 0.07
18 0.07
19 0.06
20 0.07
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.1
27 0.11
28 0.12
29 0.15
30 0.17
31 0.17
32 0.21
33 0.28
34 0.27
35 0.27
36 0.25
37 0.27
38 0.25
39 0.26
40 0.22
41 0.16
42 0.15
43 0.14
44 0.14
45 0.09
46 0.08
47 0.08
48 0.12
49 0.17
50 0.19
51 0.28
52 0.38
53 0.49
54 0.58
55 0.69
56 0.75
57 0.8
58 0.89
59 0.92
60 0.93
61 0.94
62 0.94
63 0.93
64 0.94
65 0.94
66 0.94
67 0.94
68 0.92
69 0.91