Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A3T4

Protein Details
Accession A0A545A3T4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-101LSKAEVRRMKRKQRAEEKKLRDQAKKEYQSARKSKKFPKKINKKPDEANRPRTPBasic
NLS Segment(s)
PositionSequence
50-105KAEVRRMKRKQRAEEKKLRDQAKKEYQSARKSKKFPKKINKKPDEANRPRTPSPTR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MECQNCRNYQVENSPRSDPPLSSREISVEPTVADASSSKKFLEDDSKLSKAEVRRMKRKQRAEEKKLRDQAKKEYQSARKSKKFPKKINKKPDEANRPRTPSPTRAAKNQPAESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.51
4 0.46
5 0.37
6 0.34
7 0.33
8 0.32
9 0.29
10 0.29
11 0.26
12 0.26
13 0.27
14 0.22
15 0.19
16 0.15
17 0.15
18 0.14
19 0.11
20 0.1
21 0.08
22 0.1
23 0.12
24 0.13
25 0.12
26 0.12
27 0.13
28 0.15
29 0.22
30 0.21
31 0.24
32 0.29
33 0.3
34 0.3
35 0.29
36 0.3
37 0.24
38 0.31
39 0.33
40 0.35
41 0.44
42 0.53
43 0.63
44 0.69
45 0.75
46 0.77
47 0.8
48 0.83
49 0.83
50 0.84
51 0.82
52 0.82
53 0.81
54 0.78
55 0.72
56 0.66
57 0.66
58 0.66
59 0.64
60 0.6
61 0.61
62 0.62
63 0.66
64 0.72
65 0.72
66 0.7
67 0.73
68 0.78
69 0.8
70 0.83
71 0.84
72 0.85
73 0.87
74 0.89
75 0.93
76 0.91
77 0.86
78 0.85
79 0.85
80 0.85
81 0.83
82 0.83
83 0.8
84 0.79
85 0.75
86 0.72
87 0.68
88 0.63
89 0.61
90 0.62
91 0.58
92 0.6
93 0.67
94 0.69
95 0.72