Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V2E3

Protein Details
Accession H1V2E3   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-113RRAVLLPHHRPRRLRRRRIAKHPSLPPPPSBasic
NLS Segment(s)
PositionSequence
86-114RRAVLLPHHRPRRLRRRRIAKHPSLPPPP
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSLDDPPRVADRAALSDGRRRPEILASRQRSRLDQLQASRHRILLPSEHDRGRNRGSVGSVXNGSGSSRSRSRSSESGSGRPXLYRRAVLLPHHRPRRLRRRRIAKHPSLPPPPSPLPPPQEPAPTVAKTPPRGPAALRAPPTGPAATRNFSAPAGSPAVQPPRHPQTPSVPPPRADATSPTIPPAGPRGYVAPPRGGGYSARGGRGSWSGPSPRQAPVPTTSPSSTPSTIPTGPRANPSNSISSNPSPAPKAFNPPTGPSSQHGAGGARPTLAQSMLATLPPIIPGGKIDPSLLPTTTGITRDIEPHYKKLKAEEEKARADLDTKEDKLRQSLQMWDKLEMESKAWKTRVDLSEQSLNNLAGEGVGGAAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.36
4 0.41
5 0.42
6 0.41
7 0.38
8 0.36
9 0.42
10 0.48
11 0.51
12 0.56
13 0.59
14 0.64
15 0.69
16 0.69
17 0.63
18 0.61
19 0.58
20 0.56
21 0.56
22 0.56
23 0.59
24 0.64
25 0.68
26 0.63
27 0.56
28 0.5
29 0.45
30 0.41
31 0.38
32 0.37
33 0.38
34 0.42
35 0.44
36 0.48
37 0.49
38 0.53
39 0.51
40 0.48
41 0.43
42 0.4
43 0.39
44 0.38
45 0.37
46 0.34
47 0.3
48 0.25
49 0.24
50 0.22
51 0.2
52 0.17
53 0.19
54 0.18
55 0.21
56 0.25
57 0.27
58 0.32
59 0.37
60 0.42
61 0.46
62 0.48
63 0.49
64 0.5
65 0.5
66 0.47
67 0.44
68 0.41
69 0.35
70 0.33
71 0.29
72 0.27
73 0.3
74 0.34
75 0.42
76 0.49
77 0.55
78 0.61
79 0.64
80 0.7
81 0.74
82 0.79
83 0.8
84 0.81
85 0.82
86 0.84
87 0.89
88 0.93
89 0.93
90 0.92
91 0.9
92 0.88
93 0.86
94 0.83
95 0.76
96 0.67
97 0.64
98 0.57
99 0.5
100 0.46
101 0.43
102 0.41
103 0.41
104 0.43
105 0.38
106 0.39
107 0.37
108 0.37
109 0.35
110 0.3
111 0.28
112 0.29
113 0.31
114 0.3
115 0.32
116 0.34
117 0.3
118 0.31
119 0.3
120 0.33
121 0.35
122 0.38
123 0.37
124 0.33
125 0.31
126 0.32
127 0.33
128 0.25
129 0.19
130 0.18
131 0.19
132 0.19
133 0.19
134 0.18
135 0.18
136 0.17
137 0.17
138 0.13
139 0.12
140 0.14
141 0.14
142 0.13
143 0.15
144 0.22
145 0.22
146 0.22
147 0.26
148 0.3
149 0.33
150 0.33
151 0.33
152 0.34
153 0.43
154 0.5
155 0.52
156 0.47
157 0.45
158 0.47
159 0.47
160 0.41
161 0.32
162 0.26
163 0.23
164 0.24
165 0.24
166 0.22
167 0.2
168 0.18
169 0.18
170 0.19
171 0.14
172 0.11
173 0.11
174 0.13
175 0.16
176 0.2
177 0.21
178 0.18
179 0.18
180 0.18
181 0.18
182 0.16
183 0.13
184 0.12
185 0.17
186 0.17
187 0.17
188 0.16
189 0.16
190 0.17
191 0.18
192 0.16
193 0.11
194 0.13
195 0.15
196 0.16
197 0.2
198 0.2
199 0.2
200 0.23
201 0.22
202 0.22
203 0.22
204 0.25
205 0.23
206 0.25
207 0.24
208 0.22
209 0.24
210 0.25
211 0.23
212 0.2
213 0.2
214 0.21
215 0.23
216 0.23
217 0.25
218 0.26
219 0.26
220 0.31
221 0.32
222 0.3
223 0.32
224 0.33
225 0.34
226 0.3
227 0.32
228 0.31
229 0.29
230 0.3
231 0.27
232 0.26
233 0.23
234 0.23
235 0.27
236 0.24
237 0.32
238 0.31
239 0.36
240 0.37
241 0.38
242 0.41
243 0.37
244 0.38
245 0.3
246 0.32
247 0.27
248 0.25
249 0.22
250 0.19
251 0.19
252 0.19
253 0.18
254 0.13
255 0.12
256 0.12
257 0.12
258 0.11
259 0.1
260 0.07
261 0.09
262 0.09
263 0.09
264 0.09
265 0.09
266 0.09
267 0.08
268 0.09
269 0.07
270 0.06
271 0.08
272 0.1
273 0.12
274 0.12
275 0.13
276 0.13
277 0.16
278 0.18
279 0.17
280 0.16
281 0.14
282 0.16
283 0.17
284 0.17
285 0.16
286 0.16
287 0.16
288 0.19
289 0.23
290 0.3
291 0.31
292 0.38
293 0.43
294 0.45
295 0.45
296 0.48
297 0.54
298 0.53
299 0.59
300 0.61
301 0.62
302 0.63
303 0.63
304 0.56
305 0.47
306 0.41
307 0.34
308 0.31
309 0.31
310 0.29
311 0.34
312 0.36
313 0.38
314 0.41
315 0.44
316 0.43
317 0.38
318 0.45
319 0.46
320 0.51
321 0.51
322 0.48
323 0.44
324 0.4
325 0.42
326 0.34
327 0.29
328 0.29
329 0.32
330 0.37
331 0.38
332 0.38
333 0.36
334 0.45
335 0.46
336 0.46
337 0.46
338 0.44
339 0.51
340 0.5
341 0.49
342 0.43
343 0.39
344 0.31
345 0.27
346 0.2
347 0.11
348 0.11
349 0.08