Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545AC55

Protein Details
Accession A0A545AC55   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRGKRSKQYRKLMQQYGLSFHydrophilic
259-284IEASEVLLKRRKRKHKPVGSGKGPMIHydrophilic
NLS Segment(s)
PositionSequence
179-191GVRRGNGILKRKR
211-231KKKAARGAKGPNPLSVKKPKS
267-279KRRKRKHKPVGSG
Subcellular Location(s) mito 13.5mito_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
IPR029060  PIN-like_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04900  Fcf1  
CDD cd09865  PIN_ScUtp23p-like  
Amino Acid Sequences MRGKRSKQYRKLMQQYGLSFGFREPYQVLLDADIIRDADRFKMDLIGGLERTLNGKVKPMITQCSMRHLYESATEPGMSYVIEKAKSYERRRCGHLPSDYPVPLSTQSCMTSVVDPKSSGNNKHRYVIASQDLDVRKSMRELMGVPLIYIHRSVMIMEPMAGKTAENREKEELVKLRAGVRRGNGILKRKRSDLHPEEDLRNGENGQISTKKKAARGAKGPNPLSVKKPKSNSKNEVVLKATKVDQDLPLTSEAKTTPIEASEVLLKRRKRKHKPVGSGKGPMITSADQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.73
3 0.68
4 0.58
5 0.48
6 0.38
7 0.3
8 0.28
9 0.2
10 0.21
11 0.16
12 0.17
13 0.19
14 0.2
15 0.2
16 0.17
17 0.19
18 0.16
19 0.16
20 0.14
21 0.12
22 0.11
23 0.11
24 0.11
25 0.11
26 0.12
27 0.13
28 0.12
29 0.15
30 0.15
31 0.17
32 0.19
33 0.2
34 0.18
35 0.18
36 0.18
37 0.15
38 0.17
39 0.16
40 0.17
41 0.14
42 0.19
43 0.21
44 0.23
45 0.28
46 0.3
47 0.32
48 0.32
49 0.39
50 0.35
51 0.41
52 0.42
53 0.37
54 0.36
55 0.31
56 0.29
57 0.25
58 0.28
59 0.21
60 0.19
61 0.19
62 0.17
63 0.16
64 0.15
65 0.11
66 0.08
67 0.09
68 0.11
69 0.12
70 0.12
71 0.14
72 0.23
73 0.32
74 0.39
75 0.45
76 0.5
77 0.53
78 0.6
79 0.63
80 0.61
81 0.6
82 0.59
83 0.54
84 0.5
85 0.51
86 0.45
87 0.4
88 0.34
89 0.27
90 0.23
91 0.2
92 0.16
93 0.13
94 0.14
95 0.13
96 0.14
97 0.14
98 0.14
99 0.17
100 0.18
101 0.17
102 0.17
103 0.17
104 0.23
105 0.26
106 0.3
107 0.35
108 0.42
109 0.42
110 0.44
111 0.44
112 0.39
113 0.37
114 0.35
115 0.31
116 0.23
117 0.22
118 0.25
119 0.24
120 0.23
121 0.23
122 0.18
123 0.14
124 0.14
125 0.15
126 0.09
127 0.1
128 0.1
129 0.11
130 0.13
131 0.13
132 0.12
133 0.11
134 0.11
135 0.1
136 0.1
137 0.07
138 0.05
139 0.05
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.07
146 0.07
147 0.08
148 0.07
149 0.06
150 0.07
151 0.15
152 0.21
153 0.21
154 0.24
155 0.26
156 0.27
157 0.29
158 0.32
159 0.28
160 0.25
161 0.25
162 0.23
163 0.27
164 0.28
165 0.29
166 0.26
167 0.24
168 0.26
169 0.26
170 0.31
171 0.31
172 0.38
173 0.43
174 0.49
175 0.5
176 0.49
177 0.5
178 0.48
179 0.53
180 0.5
181 0.48
182 0.47
183 0.47
184 0.46
185 0.48
186 0.44
187 0.34
188 0.29
189 0.23
190 0.18
191 0.16
192 0.15
193 0.15
194 0.2
195 0.21
196 0.24
197 0.29
198 0.3
199 0.31
200 0.39
201 0.44
202 0.46
203 0.53
204 0.59
205 0.63
206 0.69
207 0.67
208 0.65
209 0.63
210 0.56
211 0.54
212 0.55
213 0.55
214 0.53
215 0.6
216 0.64
217 0.68
218 0.76
219 0.76
220 0.74
221 0.76
222 0.72
223 0.69
224 0.63
225 0.57
226 0.48
227 0.43
228 0.38
229 0.31
230 0.29
231 0.27
232 0.25
233 0.25
234 0.25
235 0.24
236 0.25
237 0.23
238 0.21
239 0.21
240 0.18
241 0.17
242 0.16
243 0.16
244 0.14
245 0.14
246 0.16
247 0.13
248 0.15
249 0.2
250 0.23
251 0.27
252 0.33
253 0.38
254 0.46
255 0.57
256 0.66
257 0.7
258 0.78
259 0.83
260 0.87
261 0.93
262 0.94
263 0.95
264 0.91
265 0.87
266 0.78
267 0.72
268 0.61
269 0.51