Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZWA6

Protein Details
Accession A0A544ZWA6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
108-136DGSKYNMKDGQKRRRRLRLRDGSHAKCVIHydrophilic
NLS Segment(s)
PositionSequence
119-125KRRRRLR
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0016020  C:membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
Amino Acid Sequences MKTGQGFLLVFSITSPSSLNELAGLREEIIRIKDDENIPMVIVGNKADLSESRAVPRAKGFSVSQQWNAPYYEASARTRTNVDEVFVDLSRQMLRKQDEHMNNGDGDDGSKYNMKDGQKRRRRLRLRDGSHAKCVIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.12
5 0.12
6 0.12
7 0.12
8 0.13
9 0.13
10 0.14
11 0.13
12 0.11
13 0.11
14 0.12
15 0.12
16 0.13
17 0.14
18 0.14
19 0.14
20 0.18
21 0.19
22 0.2
23 0.2
24 0.19
25 0.17
26 0.15
27 0.15
28 0.11
29 0.1
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.1
37 0.13
38 0.13
39 0.14
40 0.2
41 0.21
42 0.21
43 0.23
44 0.21
45 0.18
46 0.2
47 0.19
48 0.2
49 0.26
50 0.28
51 0.27
52 0.26
53 0.27
54 0.25
55 0.25
56 0.19
57 0.13
58 0.12
59 0.12
60 0.14
61 0.15
62 0.16
63 0.16
64 0.18
65 0.19
66 0.18
67 0.19
68 0.16
69 0.15
70 0.12
71 0.13
72 0.14
73 0.13
74 0.12
75 0.09
76 0.09
77 0.1
78 0.11
79 0.11
80 0.15
81 0.19
82 0.2
83 0.25
84 0.33
85 0.37
86 0.39
87 0.41
88 0.37
89 0.34
90 0.32
91 0.28
92 0.19
93 0.15
94 0.13
95 0.1
96 0.1
97 0.13
98 0.13
99 0.15
100 0.2
101 0.24
102 0.32
103 0.42
104 0.52
105 0.58
106 0.69
107 0.77
108 0.83
109 0.88
110 0.89
111 0.9
112 0.9
113 0.87
114 0.88
115 0.88
116 0.83
117 0.8