Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZVJ7

Protein Details
Accession A0A544ZVJ7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
13-36LELFRLEQRYTRRRNRRSTFVSNAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 6, cyto_nucl 11.5, mito 5, nucl 15
Family & Domain DBs
Amino Acid Sequences MVQKLIDRIQAKLELFRLEQRYTRRRNRRSTFVSNAIYVDGEYIYQTPNNTGSSVESTSTRIDALHGEKMGATSTRPTSTFITTTADVPSPDRKRLNRFSSVPGFGGISFNKDRTDVSTRRTSTIQW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.34
4 0.34
5 0.32
6 0.36
7 0.42
8 0.49
9 0.55
10 0.64
11 0.68
12 0.73
13 0.81
14 0.83
15 0.84
16 0.83
17 0.82
18 0.79
19 0.76
20 0.69
21 0.59
22 0.52
23 0.42
24 0.33
25 0.24
26 0.17
27 0.09
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.07
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.12
41 0.13
42 0.12
43 0.11
44 0.12
45 0.12
46 0.12
47 0.11
48 0.08
49 0.08
50 0.09
51 0.11
52 0.11
53 0.11
54 0.1
55 0.1
56 0.11
57 0.11
58 0.09
59 0.07
60 0.08
61 0.1
62 0.11
63 0.12
64 0.14
65 0.16
66 0.18
67 0.19
68 0.17
69 0.19
70 0.18
71 0.19
72 0.17
73 0.16
74 0.14
75 0.16
76 0.24
77 0.24
78 0.3
79 0.35
80 0.39
81 0.47
82 0.56
83 0.6
84 0.59
85 0.59
86 0.61
87 0.61
88 0.58
89 0.5
90 0.41
91 0.36
92 0.28
93 0.28
94 0.2
95 0.19
96 0.19
97 0.19
98 0.2
99 0.19
100 0.2
101 0.23
102 0.31
103 0.29
104 0.33
105 0.42
106 0.43
107 0.46