Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545A317

Protein Details
Accession A0A545A317    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPTTKKYIKEQKSKRTKQNQPFDSRIWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5, mito 8, cyto_nucl 7, cyto 4.5, pero 4
Family & Domain DBs
Amino Acid Sequences MPTTKKYIKEQKSKRTKQNQPFDSRIWTNFGPACLKLPSSPDEYLAAGVDFEEGGEKWRAGDPVKVCLFTVDLTSTKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.9
4 0.9
5 0.91
6 0.88
7 0.85
8 0.8
9 0.72
10 0.68
11 0.6
12 0.51
13 0.45
14 0.36
15 0.31
16 0.27
17 0.26
18 0.21
19 0.19
20 0.2
21 0.15
22 0.16
23 0.13
24 0.14
25 0.15
26 0.17
27 0.17
28 0.16
29 0.17
30 0.16
31 0.16
32 0.14
33 0.11
34 0.07
35 0.06
36 0.05
37 0.04
38 0.03
39 0.04
40 0.04
41 0.07
42 0.08
43 0.08
44 0.09
45 0.11
46 0.14
47 0.14
48 0.2
49 0.19
50 0.27
51 0.29
52 0.29
53 0.27
54 0.26
55 0.26
56 0.2
57 0.21
58 0.16
59 0.15