Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A544ZY42

Protein Details
Accession A0A544ZY42    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVKKRKNNGRNKKGRGHVKPVRCSNCBasic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHVK
Subcellular Location(s) nucl 14.5, mito_nucl 13, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVKPVRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVTKMYLKLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.84
4 0.81
5 0.8
6 0.81
7 0.81
8 0.78
9 0.7
10 0.68
11 0.65
12 0.66
13 0.64
14 0.62
15 0.58
16 0.59
17 0.62
18 0.64
19 0.66
20 0.65
21 0.67
22 0.67
23 0.69
24 0.64
25 0.65
26 0.6
27 0.6
28 0.53
29 0.46
30 0.4
31 0.33
32 0.31
33 0.25
34 0.24
35 0.15
36 0.15
37 0.12
38 0.11
39 0.11
40 0.09
41 0.09
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.07
49 0.08
50 0.1
51 0.1
52 0.1