Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545A3V7

Protein Details
Accession A0A545A3V7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
116-143NNERNPEMKKRREKGKRIIRGRKEQGDVBasic
NLS Segment(s)
PositionSequence
123-138MKKRREKGKRIIRGRK
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MIWKSRSYPAKTQSVYTGKTVKFEVFLSQADASDQSEPTSRVSSLGNAVDCFTAEYFLDEPITYDHDKEPIASEVPLTAHVNGFLARKRQRVEELLNGEDVEPRQRHGSFRSSTENNERNPEMKKRREKGKRIIRGRKEQGDVNYKNILERAKFKTNVLEFAQASTSAQNEFKKLLTGENSRRKKGNPKVFQIAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.49
4 0.5
5 0.41
6 0.42
7 0.41
8 0.33
9 0.28
10 0.27
11 0.25
12 0.2
13 0.2
14 0.21
15 0.2
16 0.19
17 0.18
18 0.18
19 0.15
20 0.14
21 0.14
22 0.11
23 0.13
24 0.14
25 0.16
26 0.17
27 0.16
28 0.15
29 0.16
30 0.16
31 0.17
32 0.19
33 0.18
34 0.16
35 0.17
36 0.15
37 0.14
38 0.14
39 0.1
40 0.08
41 0.07
42 0.09
43 0.08
44 0.09
45 0.09
46 0.08
47 0.09
48 0.09
49 0.13
50 0.11
51 0.12
52 0.12
53 0.13
54 0.14
55 0.13
56 0.15
57 0.12
58 0.13
59 0.11
60 0.11
61 0.1
62 0.1
63 0.12
64 0.1
65 0.09
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.1
72 0.17
73 0.2
74 0.23
75 0.25
76 0.27
77 0.29
78 0.32
79 0.34
80 0.33
81 0.33
82 0.3
83 0.29
84 0.26
85 0.23
86 0.19
87 0.16
88 0.14
89 0.11
90 0.11
91 0.14
92 0.15
93 0.16
94 0.19
95 0.26
96 0.23
97 0.26
98 0.32
99 0.3
100 0.33
101 0.41
102 0.42
103 0.37
104 0.39
105 0.37
106 0.33
107 0.36
108 0.42
109 0.42
110 0.46
111 0.55
112 0.58
113 0.68
114 0.75
115 0.8
116 0.81
117 0.83
118 0.84
119 0.85
120 0.88
121 0.86
122 0.87
123 0.86
124 0.82
125 0.74
126 0.68
127 0.64
128 0.64
129 0.57
130 0.5
131 0.46
132 0.39
133 0.37
134 0.35
135 0.31
136 0.23
137 0.28
138 0.32
139 0.36
140 0.37
141 0.38
142 0.44
143 0.43
144 0.45
145 0.41
146 0.4
147 0.32
148 0.32
149 0.32
150 0.23
151 0.22
152 0.17
153 0.15
154 0.12
155 0.16
156 0.16
157 0.17
158 0.19
159 0.19
160 0.22
161 0.21
162 0.24
163 0.27
164 0.35
165 0.44
166 0.53
167 0.6
168 0.61
169 0.65
170 0.65
171 0.69
172 0.71
173 0.71
174 0.71
175 0.72