Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545A7A1

Protein Details
Accession A0A545A7A1   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MVKKNRKQSSPITKRKLRKTLSKSNGRNQSRHydrophilic
NLS Segment(s)
PositionSequence
4-20KNRKQSSPITKRKLRKT
Subcellular Location(s) cyto_nucl 12.5, mito 3, nucl 21.5
Family & Domain DBs
Amino Acid Sequences MVKKNRKQSSPITKRKLRKTLSKSNGRNQSRVDGGDESDSLFMTESPQIPQPSLPCEEIFKSKPDQKFRTKYKYDDFENYTESQLKKNIFNFHYFILLKIYVSRVPRLDKRRISFNFEYYILFQDTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.88
4 0.83
5 0.83
6 0.81
7 0.83
8 0.83
9 0.85
10 0.82
11 0.82
12 0.85
13 0.78
14 0.73
15 0.64
16 0.6
17 0.52
18 0.46
19 0.39
20 0.3
21 0.27
22 0.24
23 0.21
24 0.17
25 0.14
26 0.12
27 0.09
28 0.08
29 0.07
30 0.07
31 0.09
32 0.09
33 0.1
34 0.14
35 0.14
36 0.15
37 0.16
38 0.15
39 0.17
40 0.19
41 0.18
42 0.15
43 0.16
44 0.17
45 0.2
46 0.21
47 0.2
48 0.21
49 0.26
50 0.31
51 0.37
52 0.42
53 0.47
54 0.55
55 0.6
56 0.66
57 0.64
58 0.64
59 0.63
60 0.63
61 0.58
62 0.55
63 0.51
64 0.43
65 0.42
66 0.38
67 0.32
68 0.3
69 0.27
70 0.23
71 0.23
72 0.24
73 0.25
74 0.28
75 0.34
76 0.32
77 0.35
78 0.35
79 0.32
80 0.36
81 0.31
82 0.28
83 0.23
84 0.21
85 0.18
86 0.17
87 0.19
88 0.17
89 0.19
90 0.22
91 0.23
92 0.29
93 0.38
94 0.44
95 0.52
96 0.57
97 0.59
98 0.66
99 0.66
100 0.68
101 0.65
102 0.61
103 0.56
104 0.48
105 0.46
106 0.38
107 0.38