Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VTT3

Protein Details
Accession H1VTT3    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-69FVSKVEKANKKPLKRRRPNKKLVTTMESHydrophilic
NLS Segment(s)
PositionSequence
34-62KRTMKHSAFVSKVEKANKKPLKRRRPNKK
90-110GKVRHKSLKSRPGALKRKEKV
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MARIRGDIHPLAPHKTLRPEAKVDDSFLTNKKDKRTMKHSAFVSKVEKANKKPLKRRRPNKKLVTTMESLADALPDLDEGAPTLEQLREGKVRHKSLKSRPGALKRKEKVVRGEMQRFGASMAALASVPAAPAPASPASPAVPAGAMAVEGSANGSAAPDAKPDATSSRWAALRRHISSTMEQNPAFSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.47
4 0.47
5 0.49
6 0.49
7 0.5
8 0.56
9 0.52
10 0.48
11 0.42
12 0.38
13 0.37
14 0.36
15 0.37
16 0.35
17 0.38
18 0.41
19 0.48
20 0.52
21 0.57
22 0.61
23 0.65
24 0.65
25 0.69
26 0.67
27 0.65
28 0.61
29 0.58
30 0.54
31 0.48
32 0.46
33 0.46
34 0.49
35 0.46
36 0.54
37 0.58
38 0.63
39 0.68
40 0.74
41 0.78
42 0.82
43 0.88
44 0.89
45 0.91
46 0.93
47 0.93
48 0.92
49 0.89
50 0.84
51 0.78
52 0.69
53 0.59
54 0.49
55 0.39
56 0.29
57 0.2
58 0.14
59 0.08
60 0.06
61 0.04
62 0.03
63 0.04
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.09
75 0.11
76 0.13
77 0.19
78 0.25
79 0.31
80 0.36
81 0.41
82 0.46
83 0.52
84 0.61
85 0.58
86 0.58
87 0.59
88 0.64
89 0.68
90 0.68
91 0.69
92 0.61
93 0.69
94 0.66
95 0.63
96 0.6
97 0.56
98 0.57
99 0.54
100 0.58
101 0.5
102 0.47
103 0.43
104 0.36
105 0.3
106 0.23
107 0.15
108 0.09
109 0.07
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.03
117 0.04
118 0.03
119 0.03
120 0.06
121 0.07
122 0.07
123 0.08
124 0.09
125 0.1
126 0.11
127 0.11
128 0.09
129 0.08
130 0.08
131 0.07
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.03
138 0.04
139 0.04
140 0.04
141 0.03
142 0.04
143 0.04
144 0.06
145 0.06
146 0.07
147 0.08
148 0.09
149 0.1
150 0.12
151 0.15
152 0.16
153 0.21
154 0.22
155 0.26
156 0.29
157 0.32
158 0.34
159 0.4
160 0.47
161 0.46
162 0.49
163 0.47
164 0.47
165 0.49
166 0.54
167 0.52
168 0.49
169 0.46