Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZRS5

Protein Details
Accession A0A544ZRS5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
138-167PGARHQGRRIQLQRRRDRRRPRGEPASDLLBasic
NLS Segment(s)
PositionSequence
98-160PRHHGRMAQERRRHQARRHLWHRIARLRAPDHARPAGTRHPGARHQGRRIQLQRRRDRRRPRG
Subcellular Location(s) nucl 17, mito 7, cyto 1, plas 1, extr 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036380  Isochorismatase-like_sf  
Amino Acid Sequences MQERFRTAIANFDLITNTSARMLKAASILDVPVFTTEQNPKGASLLHHHTTQTHKILTAFSRHSPRRYSGSPERPRQAAARTVVQSSTPKDQVQHGPPRHHGRMAQERRRHQARRHLWHRIARLRAPDHARPAGTRHPGARHQGRRIQLQRRRDRRRPRGEPASDLLFSFCTLAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.15
4 0.13
5 0.13
6 0.15
7 0.14
8 0.14
9 0.13
10 0.13
11 0.15
12 0.15
13 0.13
14 0.12
15 0.12
16 0.11
17 0.11
18 0.1
19 0.09
20 0.09
21 0.08
22 0.12
23 0.16
24 0.18
25 0.21
26 0.21
27 0.2
28 0.2
29 0.21
30 0.18
31 0.2
32 0.24
33 0.24
34 0.25
35 0.24
36 0.26
37 0.3
38 0.34
39 0.32
40 0.26
41 0.25
42 0.24
43 0.27
44 0.26
45 0.26
46 0.23
47 0.25
48 0.33
49 0.35
50 0.38
51 0.39
52 0.4
53 0.41
54 0.4
55 0.44
56 0.45
57 0.53
58 0.58
59 0.61
60 0.61
61 0.55
62 0.55
63 0.49
64 0.41
65 0.36
66 0.3
67 0.28
68 0.26
69 0.26
70 0.24
71 0.23
72 0.22
73 0.19
74 0.2
75 0.17
76 0.17
77 0.17
78 0.2
79 0.25
80 0.3
81 0.37
82 0.38
83 0.4
84 0.46
85 0.53
86 0.51
87 0.47
88 0.42
89 0.4
90 0.47
91 0.54
92 0.56
93 0.56
94 0.6
95 0.66
96 0.72
97 0.71
98 0.66
99 0.67
100 0.68
101 0.71
102 0.74
103 0.75
104 0.74
105 0.74
106 0.76
107 0.73
108 0.68
109 0.61
110 0.61
111 0.53
112 0.54
113 0.53
114 0.49
115 0.48
116 0.46
117 0.43
118 0.37
119 0.39
120 0.4
121 0.4
122 0.38
123 0.35
124 0.38
125 0.42
126 0.5
127 0.56
128 0.56
129 0.58
130 0.62
131 0.63
132 0.67
133 0.71
134 0.72
135 0.7
136 0.72
137 0.76
138 0.81
139 0.86
140 0.86
141 0.89
142 0.89
143 0.93
144 0.91
145 0.91
146 0.9
147 0.86
148 0.81
149 0.75
150 0.7
151 0.59
152 0.5
153 0.41
154 0.31
155 0.26