Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZSG8

Protein Details
Accession A0A544ZSG8   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
7-32LDDLDRRDKDDKKRQEKQGKDADKNABasic
230-250ADRFKKIGIKAPKGKQRPTYRBasic
NLS Segment(s)
PositionSequence
233-247FKKIGIKAPKGKQRP
Subcellular Location(s) cyto 5.5, cyto_pero 3.5, golg 1, mito 1, nucl 18, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR027417  P-loop_NTPase  
IPR032501  Prot_ATP_ID_OB_C  
Gene Ontology GO:0032991  C:protein-containing complex  
Pfam View protein in Pfam  
PF16450  Prot_ATP_ID_OB  
Amino Acid Sequences MSTLEELDDLDRRDKDDKKRQEKQGKDADKNADGDEEMKEAEEEEDDILDDEILSLSTQDIETRKRLLENDSRIMKSELSRLSHEKAAMGEKIKDNEDKIANNRQLPYLVGNVVELLDLDPTAESSEEGANIDLDATRVGKSAVIKTSTRQTIFLPLIGLVDSDTLKPGDLIGVNKDSYLILDTLPAEYDSRVKAMEVDEKPTEQYTDVGGLDKQIEELVEAIVLPMKEADRFKKIGIKAPKGKQRPTYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.46
3 0.53
4 0.61
5 0.67
6 0.76
7 0.84
8 0.88
9 0.88
10 0.87
11 0.87
12 0.86
13 0.81
14 0.78
15 0.74
16 0.67
17 0.61
18 0.52
19 0.43
20 0.33
21 0.28
22 0.22
23 0.16
24 0.12
25 0.11
26 0.1
27 0.09
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.08
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.05
46 0.08
47 0.1
48 0.13
49 0.16
50 0.18
51 0.19
52 0.21
53 0.23
54 0.27
55 0.33
56 0.37
57 0.42
58 0.44
59 0.44
60 0.44
61 0.43
62 0.38
63 0.31
64 0.31
65 0.27
66 0.25
67 0.28
68 0.3
69 0.31
70 0.32
71 0.31
72 0.25
73 0.22
74 0.22
75 0.21
76 0.2
77 0.2
78 0.2
79 0.21
80 0.23
81 0.23
82 0.21
83 0.22
84 0.23
85 0.23
86 0.25
87 0.31
88 0.32
89 0.33
90 0.33
91 0.29
92 0.27
93 0.25
94 0.22
95 0.15
96 0.12
97 0.1
98 0.09
99 0.08
100 0.08
101 0.07
102 0.05
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.06
128 0.08
129 0.11
130 0.13
131 0.16
132 0.16
133 0.18
134 0.24
135 0.27
136 0.26
137 0.25
138 0.23
139 0.26
140 0.26
141 0.25
142 0.19
143 0.15
144 0.14
145 0.13
146 0.12
147 0.06
148 0.06
149 0.06
150 0.05
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.08
158 0.09
159 0.11
160 0.13
161 0.13
162 0.13
163 0.14
164 0.12
165 0.11
166 0.11
167 0.09
168 0.06
169 0.08
170 0.08
171 0.08
172 0.09
173 0.09
174 0.08
175 0.08
176 0.11
177 0.1
178 0.11
179 0.11
180 0.1
181 0.11
182 0.13
183 0.22
184 0.21
185 0.25
186 0.26
187 0.26
188 0.28
189 0.27
190 0.26
191 0.17
192 0.17
193 0.13
194 0.14
195 0.14
196 0.14
197 0.13
198 0.13
199 0.13
200 0.13
201 0.11
202 0.09
203 0.08
204 0.07
205 0.08
206 0.07
207 0.06
208 0.05
209 0.05
210 0.08
211 0.07
212 0.07
213 0.08
214 0.09
215 0.13
216 0.18
217 0.23
218 0.27
219 0.29
220 0.31
221 0.38
222 0.4
223 0.46
224 0.51
225 0.57
226 0.61
227 0.68
228 0.76
229 0.77
230 0.82