Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A544ZQW9

Protein Details
Accession A0A544ZQW9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-48LEAKAKRQMRDQKRLAKEKGBasic
NLS Segment(s)
PositionSequence
33-49AKRQMRDQKRLAKEKGR
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences LSNSKRADPVLARSAEAHESSKAAIDSALEAKAKRQMRDQKRLAKEKGRVKNVLEAPKTDTTGEGEITTSDIIALEAKLRKTAQRGVVKMFNAVRAAQVQSAEAEKKTRKDGVLGMGRRDEKVNEMTKKGFLDLIASGGGGLKKGALEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.31
4 0.26
5 0.18
6 0.18
7 0.17
8 0.19
9 0.16
10 0.13
11 0.11
12 0.09
13 0.11
14 0.12
15 0.14
16 0.12
17 0.12
18 0.14
19 0.22
20 0.26
21 0.25
22 0.33
23 0.41
24 0.5
25 0.61
26 0.67
27 0.7
28 0.75
29 0.82
30 0.79
31 0.77
32 0.76
33 0.75
34 0.76
35 0.72
36 0.66
37 0.59
38 0.61
39 0.59
40 0.59
41 0.5
42 0.42
43 0.41
44 0.39
45 0.38
46 0.29
47 0.23
48 0.17
49 0.17
50 0.16
51 0.11
52 0.09
53 0.08
54 0.08
55 0.08
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.06
63 0.08
64 0.08
65 0.1
66 0.1
67 0.12
68 0.15
69 0.2
70 0.27
71 0.32
72 0.33
73 0.36
74 0.4
75 0.38
76 0.39
77 0.34
78 0.27
79 0.22
80 0.2
81 0.17
82 0.14
83 0.15
84 0.12
85 0.12
86 0.1
87 0.1
88 0.12
89 0.12
90 0.11
91 0.16
92 0.18
93 0.21
94 0.25
95 0.28
96 0.26
97 0.27
98 0.3
99 0.33
100 0.39
101 0.39
102 0.38
103 0.4
104 0.4
105 0.38
106 0.37
107 0.29
108 0.24
109 0.29
110 0.35
111 0.33
112 0.36
113 0.37
114 0.39
115 0.39
116 0.36
117 0.3
118 0.21
119 0.19
120 0.16
121 0.15
122 0.12
123 0.11
124 0.1
125 0.11
126 0.11
127 0.09
128 0.08
129 0.07
130 0.07