Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545A2J1

Protein Details
Accession A0A545A2J1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGLIKKLRKAKKEAKPNEKPDLVKBasic
NLS Segment(s)
PositionSequence
5-17KKLRKAKKEAKPN
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020934  Ribosomal_S15/S19_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
IPR005713  Ribosomal_S19A/S15e  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS00323  RIBOSOMAL_S19  
Amino Acid Sequences MGLIKKLRKAKKEAKPNEKPDLVKTHLRDMIVVPEMIGSVIGIYSGKEFNQIDVKPEMVGHYLGEFSISYRPVKHGRPGIGATHSSRFIPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.87
4 0.86
5 0.81
6 0.73
7 0.67
8 0.64
9 0.58
10 0.54
11 0.49
12 0.47
13 0.44
14 0.42
15 0.37
16 0.3
17 0.29
18 0.24
19 0.21
20 0.13
21 0.11
22 0.11
23 0.1
24 0.08
25 0.04
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.04
32 0.04
33 0.04
34 0.08
35 0.08
36 0.09
37 0.15
38 0.15
39 0.17
40 0.18
41 0.18
42 0.15
43 0.15
44 0.15
45 0.1
46 0.11
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.09
55 0.11
56 0.11
57 0.12
58 0.18
59 0.23
60 0.27
61 0.34
62 0.37
63 0.4
64 0.44
65 0.46
66 0.45
67 0.44
68 0.43
69 0.39
70 0.36
71 0.34
72 0.29