Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507C017

Protein Details
Accession A0A507C017    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-61QPSTLKRKRRYGFLKRVKTYHydrophilic
NLS Segment(s)
PositionSequence
47-78KRKRRYGFLKRVKTYAGRIVLRRRMLKGRRHM
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPSLPQSSPFPLMTRHPRIPIPSPFAGPLHVRFFPTYGDEYQPSTLKRKRRYGFLKRVKTYAGRIVLRRRMLKGRRHMAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.44
4 0.46
5 0.5
6 0.54
7 0.52
8 0.49
9 0.43
10 0.4
11 0.38
12 0.35
13 0.33
14 0.27
15 0.25
16 0.22
17 0.21
18 0.21
19 0.19
20 0.19
21 0.18
22 0.18
23 0.17
24 0.14
25 0.15
26 0.15
27 0.16
28 0.17
29 0.18
30 0.17
31 0.22
32 0.26
33 0.32
34 0.39
35 0.48
36 0.49
37 0.57
38 0.66
39 0.7
40 0.77
41 0.79
42 0.81
43 0.74
44 0.74
45 0.67
46 0.6
47 0.54
48 0.51
49 0.48
50 0.42
51 0.46
52 0.52
53 0.56
54 0.6
55 0.6
56 0.57
57 0.6
58 0.63
59 0.67
60 0.69