Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507C6R5

Protein Details
Accession A0A507C6R5   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
443-463LVYIRARRRRGAKDTRRGEDWBasic
NLS Segment(s)
PositionSequence
449-455RRRRGAK
Subcellular Location(s) E.R. 4, cyto 7, mito 3, nucl 4, plas 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR001563  Peptidase_S10  
IPR018202  Ser_caboxypep_ser_AS  
Gene Ontology GO:0016020  C:membrane  
GO:0004185  F:serine-type carboxypeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00450  Peptidase_S10  
PROSITE View protein in PROSITE  
PS00131  CARBOXYPEPT_SER_SER  
Amino Acid Sequences MEVPDAQGTRPHIGPISYLMTHTSASITRSMDGMFMEFGPFSVNASKVLEINQNSWGRNAHLLFVDQPAGTGFSTADQYDLTQDSATKRFMVFLENFYSIFPEFKRSELYIGGESYAGIYVPYLANEILKRREAATLIPPELDLKGIIVGNGWIDPLPQYLSYYDFATKNGILGGEYAKYARADIENCKRAFSKGGPKIHYDTCDMIMERVLLQSRAGNRPCINMYDIRSKDSKPNGDCGLSEWPKSLPYVTEYLGRADVLTAIHTTKKTKWTECDDKVGSSLRSDPSLPSSVLLPYLTSKIQVLLFSGDQDLICNHMGTELFLSNLTWNGATGMSNATTYSYLIDDVNIGSWQSSRNMSYVLIYGASHMPAVDVPVAVWDMLNRFIGVVDTSRGTSLLLDPSGSPSPIPSSAPQKGPQVYYGWVGIVIAILIMSLFASVLILVYIRARRRRGAKDTRRGEDWHELRGAEDDEEEEMFDADRYLDDDNSAGRKGNGGGVARFEIDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.22
5 0.22
6 0.22
7 0.21
8 0.21
9 0.2
10 0.18
11 0.14
12 0.16
13 0.19
14 0.18
15 0.17
16 0.18
17 0.18
18 0.17
19 0.15
20 0.15
21 0.12
22 0.11
23 0.11
24 0.1
25 0.1
26 0.11
27 0.1
28 0.11
29 0.13
30 0.14
31 0.14
32 0.17
33 0.18
34 0.16
35 0.2
36 0.25
37 0.23
38 0.25
39 0.31
40 0.33
41 0.33
42 0.34
43 0.33
44 0.28
45 0.33
46 0.31
47 0.25
48 0.23
49 0.24
50 0.23
51 0.23
52 0.23
53 0.16
54 0.16
55 0.14
56 0.14
57 0.12
58 0.11
59 0.09
60 0.08
61 0.11
62 0.1
63 0.1
64 0.09
65 0.09
66 0.11
67 0.12
68 0.12
69 0.1
70 0.13
71 0.16
72 0.19
73 0.2
74 0.19
75 0.18
76 0.2
77 0.2
78 0.23
79 0.21
80 0.22
81 0.25
82 0.25
83 0.25
84 0.23
85 0.24
86 0.18
87 0.19
88 0.15
89 0.17
90 0.17
91 0.18
92 0.23
93 0.22
94 0.24
95 0.23
96 0.26
97 0.21
98 0.21
99 0.2
100 0.16
101 0.14
102 0.13
103 0.11
104 0.07
105 0.05
106 0.04
107 0.05
108 0.06
109 0.06
110 0.07
111 0.07
112 0.09
113 0.11
114 0.16
115 0.18
116 0.19
117 0.2
118 0.2
119 0.22
120 0.21
121 0.22
122 0.25
123 0.27
124 0.26
125 0.25
126 0.24
127 0.23
128 0.22
129 0.2
130 0.12
131 0.07
132 0.08
133 0.08
134 0.07
135 0.06
136 0.07
137 0.06
138 0.06
139 0.06
140 0.04
141 0.05
142 0.05
143 0.06
144 0.07
145 0.07
146 0.08
147 0.09
148 0.11
149 0.12
150 0.14
151 0.16
152 0.15
153 0.15
154 0.17
155 0.16
156 0.14
157 0.13
158 0.11
159 0.08
160 0.09
161 0.09
162 0.07
163 0.08
164 0.07
165 0.08
166 0.08
167 0.08
168 0.09
169 0.1
170 0.11
171 0.19
172 0.29
173 0.35
174 0.35
175 0.36
176 0.36
177 0.35
178 0.36
179 0.34
180 0.35
181 0.36
182 0.43
183 0.43
184 0.46
185 0.49
186 0.48
187 0.44
188 0.36
189 0.3
190 0.24
191 0.24
192 0.21
193 0.17
194 0.15
195 0.13
196 0.11
197 0.1
198 0.09
199 0.07
200 0.07
201 0.1
202 0.13
203 0.2
204 0.21
205 0.23
206 0.23
207 0.26
208 0.27
209 0.26
210 0.24
211 0.2
212 0.23
213 0.29
214 0.29
215 0.28
216 0.29
217 0.29
218 0.33
219 0.36
220 0.39
221 0.31
222 0.35
223 0.34
224 0.33
225 0.32
226 0.28
227 0.31
228 0.25
229 0.24
230 0.2
231 0.19
232 0.19
233 0.19
234 0.16
235 0.08
236 0.09
237 0.11
238 0.11
239 0.14
240 0.14
241 0.15
242 0.15
243 0.14
244 0.12
245 0.09
246 0.09
247 0.06
248 0.06
249 0.06
250 0.06
251 0.08
252 0.09
253 0.11
254 0.14
255 0.22
256 0.25
257 0.28
258 0.33
259 0.4
260 0.48
261 0.49
262 0.53
263 0.46
264 0.42
265 0.41
266 0.38
267 0.29
268 0.21
269 0.21
270 0.15
271 0.15
272 0.15
273 0.14
274 0.15
275 0.17
276 0.16
277 0.13
278 0.13
279 0.12
280 0.12
281 0.12
282 0.08
283 0.07
284 0.09
285 0.09
286 0.09
287 0.09
288 0.09
289 0.1
290 0.1
291 0.1
292 0.1
293 0.1
294 0.1
295 0.1
296 0.09
297 0.08
298 0.08
299 0.08
300 0.08
301 0.08
302 0.08
303 0.07
304 0.08
305 0.08
306 0.08
307 0.1
308 0.07
309 0.07
310 0.07
311 0.08
312 0.07
313 0.08
314 0.08
315 0.06
316 0.06
317 0.06
318 0.06
319 0.06
320 0.07
321 0.07
322 0.07
323 0.07
324 0.07
325 0.07
326 0.07
327 0.07
328 0.08
329 0.07
330 0.07
331 0.07
332 0.07
333 0.07
334 0.07
335 0.07
336 0.07
337 0.06
338 0.06
339 0.06
340 0.07
341 0.09
342 0.11
343 0.11
344 0.12
345 0.13
346 0.13
347 0.13
348 0.13
349 0.12
350 0.1
351 0.09
352 0.1
353 0.1
354 0.1
355 0.09
356 0.07
357 0.07
358 0.07
359 0.08
360 0.07
361 0.06
362 0.05
363 0.06
364 0.07
365 0.06
366 0.06
367 0.06
368 0.07
369 0.08
370 0.09
371 0.08
372 0.08
373 0.08
374 0.08
375 0.09
376 0.09
377 0.08
378 0.09
379 0.1
380 0.1
381 0.1
382 0.09
383 0.09
384 0.1
385 0.12
386 0.11
387 0.11
388 0.11
389 0.16
390 0.17
391 0.17
392 0.14
393 0.12
394 0.16
395 0.17
396 0.19
397 0.18
398 0.25
399 0.3
400 0.35
401 0.37
402 0.41
403 0.43
404 0.42
405 0.4
406 0.35
407 0.31
408 0.29
409 0.26
410 0.19
411 0.16
412 0.14
413 0.11
414 0.08
415 0.06
416 0.04
417 0.03
418 0.03
419 0.02
420 0.02
421 0.02
422 0.02
423 0.02
424 0.02
425 0.03
426 0.03
427 0.03
428 0.03
429 0.03
430 0.04
431 0.08
432 0.13
433 0.21
434 0.28
435 0.31
436 0.39
437 0.48
438 0.58
439 0.65
440 0.71
441 0.75
442 0.79
443 0.84
444 0.83
445 0.78
446 0.71
447 0.67
448 0.66
449 0.58
450 0.52
451 0.46
452 0.4
453 0.36
454 0.37
455 0.32
456 0.21
457 0.2
458 0.15
459 0.14
460 0.14
461 0.13
462 0.1
463 0.09
464 0.09
465 0.08
466 0.08
467 0.07
468 0.07
469 0.08
470 0.1
471 0.1
472 0.1
473 0.11
474 0.14
475 0.17
476 0.18
477 0.18
478 0.16
479 0.18
480 0.19
481 0.22
482 0.24
483 0.24
484 0.25
485 0.27
486 0.29
487 0.27