Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507BUD3

Protein Details
Accession A0A507BUD3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-99VRYQERFERKHDRKRRKLGETHWRKYBasic
NLS Segment(s)
PositionSequence
82-92RKHDRKRRKLG
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MQHIQHTILTSLLAARRILPSCIPLQYHIARHYRVHMPTTESRGRSVAVKSNSVTQAYYKLKSILDESKVRQTVRYQERFERKHDRKRRKLGETHWRKYMSYVKGSVKKAWSLKRRTLLEEQTYRDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.19
4 0.2
5 0.22
6 0.2
7 0.21
8 0.22
9 0.25
10 0.24
11 0.22
12 0.26
13 0.28
14 0.32
15 0.34
16 0.36
17 0.35
18 0.35
19 0.38
20 0.39
21 0.37
22 0.35
23 0.31
24 0.33
25 0.35
26 0.41
27 0.42
28 0.36
29 0.35
30 0.33
31 0.32
32 0.28
33 0.26
34 0.26
35 0.22
36 0.24
37 0.23
38 0.27
39 0.28
40 0.26
41 0.23
42 0.17
43 0.22
44 0.23
45 0.23
46 0.19
47 0.19
48 0.19
49 0.19
50 0.22
51 0.18
52 0.19
53 0.22
54 0.23
55 0.28
56 0.31
57 0.3
58 0.29
59 0.27
60 0.33
61 0.39
62 0.45
63 0.41
64 0.47
65 0.57
66 0.58
67 0.62
68 0.63
69 0.63
70 0.66
71 0.73
72 0.76
73 0.77
74 0.86
75 0.88
76 0.86
77 0.86
78 0.84
79 0.85
80 0.85
81 0.79
82 0.76
83 0.68
84 0.6
85 0.57
86 0.56
87 0.5
88 0.45
89 0.46
90 0.48
91 0.53
92 0.56
93 0.57
94 0.52
95 0.53
96 0.55
97 0.59
98 0.59
99 0.6
100 0.65
101 0.69
102 0.7
103 0.69
104 0.7
105 0.69
106 0.69
107 0.68