Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507BWS5

Protein Details
Accession A0A507BWS5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-44AKTAEKKTTSSDKKKPRKARKETYSTYIHydrophilic
NLS Segment(s)
PositionSequence
7-37GGKKPAGKMPAKTAEKKTTSSDKKKPRKARK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MPPKETGGKKPAGKMPAKTAEKKTTSSDKKKPRKARKETYSTYIYKVLKQVHPDTGISNKAMSIMNSFVNDIFERIATEASKLASYNKRSTISSREIQTSVRLILPGELSKHAVSEGTKAVTKYQSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.59
4 0.62
5 0.62
6 0.63
7 0.64
8 0.62
9 0.6
10 0.58
11 0.58
12 0.62
13 0.65
14 0.67
15 0.69
16 0.76
17 0.84
18 0.89
19 0.89
20 0.9
21 0.91
22 0.92
23 0.91
24 0.9
25 0.84
26 0.79
27 0.75
28 0.65
29 0.57
30 0.53
31 0.44
32 0.36
33 0.36
34 0.36
35 0.32
36 0.35
37 0.35
38 0.32
39 0.32
40 0.31
41 0.27
42 0.25
43 0.24
44 0.19
45 0.16
46 0.13
47 0.12
48 0.12
49 0.11
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.08
56 0.09
57 0.09
58 0.08
59 0.07
60 0.06
61 0.06
62 0.07
63 0.08
64 0.06
65 0.07
66 0.07
67 0.08
68 0.08
69 0.08
70 0.13
71 0.19
72 0.23
73 0.27
74 0.31
75 0.32
76 0.33
77 0.37
78 0.39
79 0.38
80 0.39
81 0.38
82 0.36
83 0.35
84 0.35
85 0.34
86 0.29
87 0.25
88 0.2
89 0.18
90 0.14
91 0.15
92 0.16
93 0.16
94 0.16
95 0.16
96 0.18
97 0.17
98 0.17
99 0.16
100 0.16
101 0.14
102 0.16
103 0.18
104 0.18
105 0.21
106 0.21
107 0.25
108 0.28