Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507C7Y5

Protein Details
Accession A0A507C7Y5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
107-140VKGQTPKVEKQEKRKKKTGRAKKRIIYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
94-131RGKVHGSLARAGKVKGQTPKVEKQEKRKKKTGRAKKRI
Subcellular Location(s) nucl 13.5cyto_nucl 13.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013641  KTI12/PSTK  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0005524  F:ATP binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF08433  KTI12  
PF04758  Ribosomal_S30  
Amino Acid Sequences MRFEEPDPRNRWDSPCFTIAPEDDLIERYGEALIEALIFKKGTKPHTATHKSVVTPSNYLHDMDKTLGDIVARIIESQKDNFSDHDGLVVPRSRGKVHGSLARAGKVKGQTPKVEKQEKRKKKTGRAKKRIIYNRRFVNVVAGFGGKKRQMNPAPTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.42
4 0.39
5 0.39
6 0.35
7 0.31
8 0.25
9 0.21
10 0.18
11 0.18
12 0.17
13 0.14
14 0.13
15 0.09
16 0.09
17 0.08
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.11
28 0.15
29 0.19
30 0.26
31 0.29
32 0.34
33 0.45
34 0.51
35 0.5
36 0.52
37 0.52
38 0.45
39 0.45
40 0.43
41 0.34
42 0.3
43 0.27
44 0.24
45 0.22
46 0.22
47 0.19
48 0.16
49 0.15
50 0.13
51 0.13
52 0.1
53 0.09
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.07
63 0.08
64 0.09
65 0.1
66 0.11
67 0.11
68 0.12
69 0.15
70 0.15
71 0.13
72 0.13
73 0.13
74 0.11
75 0.13
76 0.14
77 0.11
78 0.12
79 0.14
80 0.13
81 0.15
82 0.19
83 0.21
84 0.23
85 0.28
86 0.27
87 0.31
88 0.32
89 0.33
90 0.31
91 0.27
92 0.27
93 0.25
94 0.28
95 0.3
96 0.33
97 0.36
98 0.41
99 0.5
100 0.55
101 0.62
102 0.62
103 0.67
104 0.74
105 0.77
106 0.8
107 0.81
108 0.82
109 0.83
110 0.88
111 0.88
112 0.89
113 0.89
114 0.9
115 0.88
116 0.89
117 0.88
118 0.88
119 0.86
120 0.84
121 0.82
122 0.74
123 0.69
124 0.58
125 0.57
126 0.47
127 0.39
128 0.31
129 0.24
130 0.21
131 0.21
132 0.27
133 0.22
134 0.25
135 0.27
136 0.35
137 0.41
138 0.49
139 0.54