Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507CEH3

Protein Details
Accession A0A507CEH3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-34RVSTGNEKRSNRPQKYKNSYAYKNKSTKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019351  DUF2039  
Pfam View protein in Pfam  
PF10217  DUF2039  
Amino Acid Sequences MVDTGRVSTGNEKRSNRPQKYKNSYAYKNKSTKSQDIEKLPIKGLCRHCKDIIEWRRRYNKYKPLTQPKTCLQCRNKAITDAYHVICNKCANEAGVCAKCRLSETVLPATVKLPEELLSEQQSLEALLASMSERHRRSYLRKMDKGDTEGAEKIVAKAQATNADDEDDFDLEDDLEDEEDEDEDDDEEAESVSKHVKHLQLADEDVDEPEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.73
3 0.74
4 0.78
5 0.78
6 0.81
7 0.87
8 0.88
9 0.87
10 0.86
11 0.85
12 0.86
13 0.86
14 0.84
15 0.83
16 0.75
17 0.75
18 0.72
19 0.7
20 0.66
21 0.66
22 0.64
23 0.62
24 0.67
25 0.63
26 0.58
27 0.52
28 0.48
29 0.42
30 0.42
31 0.46
32 0.48
33 0.5
34 0.53
35 0.53
36 0.52
37 0.53
38 0.56
39 0.57
40 0.57
41 0.55
42 0.58
43 0.66
44 0.69
45 0.72
46 0.71
47 0.7
48 0.67
49 0.72
50 0.74
51 0.76
52 0.79
53 0.77
54 0.74
55 0.72
56 0.74
57 0.69
58 0.68
59 0.61
60 0.61
61 0.61
62 0.62
63 0.56
64 0.49
65 0.47
66 0.38
67 0.39
68 0.34
69 0.29
70 0.26
71 0.25
72 0.22
73 0.23
74 0.22
75 0.17
76 0.14
77 0.14
78 0.11
79 0.1
80 0.12
81 0.15
82 0.16
83 0.17
84 0.16
85 0.16
86 0.16
87 0.16
88 0.16
89 0.14
90 0.14
91 0.17
92 0.19
93 0.2
94 0.2
95 0.19
96 0.18
97 0.17
98 0.14
99 0.11
100 0.08
101 0.08
102 0.09
103 0.1
104 0.11
105 0.12
106 0.12
107 0.11
108 0.11
109 0.1
110 0.08
111 0.07
112 0.05
113 0.03
114 0.03
115 0.03
116 0.03
117 0.06
118 0.08
119 0.15
120 0.16
121 0.18
122 0.22
123 0.26
124 0.32
125 0.4
126 0.49
127 0.53
128 0.58
129 0.61
130 0.63
131 0.63
132 0.6
133 0.53
134 0.43
135 0.36
136 0.31
137 0.26
138 0.21
139 0.18
140 0.15
141 0.15
142 0.14
143 0.12
144 0.12
145 0.14
146 0.19
147 0.2
148 0.21
149 0.18
150 0.19
151 0.19
152 0.19
153 0.19
154 0.12
155 0.11
156 0.1
157 0.09
158 0.07
159 0.07
160 0.07
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.11
180 0.12
181 0.14
182 0.2
183 0.24
184 0.28
185 0.32
186 0.36
187 0.36
188 0.37
189 0.36
190 0.32
191 0.29