Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507C2A0

Protein Details
Accession A0A507C2A0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-74SLETARERKKNWKERNQAAGLPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MTRPEACESVGTEFRSCVDRVGFWGRLKGDCEALKVEFESCMSRELQKRRSESLETARERKKNWKERNQAAGLPAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.19
5 0.15
6 0.14
7 0.17
8 0.23
9 0.27
10 0.24
11 0.28
12 0.27
13 0.28
14 0.29
15 0.26
16 0.24
17 0.2
18 0.21
19 0.19
20 0.18
21 0.17
22 0.15
23 0.14
24 0.09
25 0.1
26 0.09
27 0.08
28 0.09
29 0.09
30 0.13
31 0.2
32 0.26
33 0.33
34 0.38
35 0.41
36 0.44
37 0.48
38 0.47
39 0.46
40 0.49
41 0.51
42 0.49
43 0.54
44 0.57
45 0.56
46 0.56
47 0.61
48 0.63
49 0.64
50 0.7
51 0.73
52 0.77
53 0.82
54 0.89
55 0.83
56 0.75
57 0.66