Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512U842

Protein Details
Accession A0A512U842    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNSRFKRGKNLGKYPRCKAKQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.666, mito 12.5, nucl 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MNSRFKRGKNLGKYPRCKAKQSWVRPIMHPSTLPQELPNTPSRIIQHSLRAPPESHIEASSPSHLNYPRPFIPLKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.8
4 0.75
5 0.69
6 0.7
7 0.7
8 0.71
9 0.73
10 0.7
11 0.68
12 0.65
13 0.66
14 0.58
15 0.49
16 0.41
17 0.32
18 0.29
19 0.27
20 0.25
21 0.2
22 0.19
23 0.18
24 0.2
25 0.22
26 0.19
27 0.18
28 0.2
29 0.21
30 0.22
31 0.24
32 0.23
33 0.26
34 0.29
35 0.33
36 0.33
37 0.33
38 0.3
39 0.29
40 0.32
41 0.28
42 0.24
43 0.21
44 0.2
45 0.2
46 0.21
47 0.23
48 0.19
49 0.17
50 0.21
51 0.23
52 0.29
53 0.31
54 0.36
55 0.34
56 0.37