Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512UI15

Protein Details
Accession A0A512UI15    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-82IKKANKIEKAKRNKQLKKNLEKEKLFHydrophilic
NLS Segment(s)
PositionSequence
51-79RLSKEDIKKANKIEKAKRNKQLKKNLEKE
Subcellular Location(s) nucl 19, cyto_nucl 13, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MAFSSSSSKTRSQATVNKLFESMLPGCTSKSKAQKKSSTTENFSREVSQKRLSKEDIKKANKIEKAKRNKQLKKNLEKEKLFNKNVKYNVIKSHKNSENISEEEQKYLKKANKEELFCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.53
4 0.51
5 0.47
6 0.43
7 0.36
8 0.33
9 0.26
10 0.18
11 0.17
12 0.16
13 0.17
14 0.19
15 0.23
16 0.24
17 0.33
18 0.41
19 0.48
20 0.57
21 0.64
22 0.66
23 0.68
24 0.71
25 0.68
26 0.65
27 0.63
28 0.58
29 0.51
30 0.47
31 0.45
32 0.39
33 0.37
34 0.35
35 0.35
36 0.36
37 0.37
38 0.4
39 0.4
40 0.45
41 0.48
42 0.52
43 0.54
44 0.54
45 0.56
46 0.56
47 0.6
48 0.56
49 0.56
50 0.56
51 0.56
52 0.62
53 0.67
54 0.72
55 0.76
56 0.8
57 0.81
58 0.83
59 0.84
60 0.84
61 0.85
62 0.86
63 0.84
64 0.78
65 0.74
66 0.73
67 0.72
68 0.66
69 0.62
70 0.57
71 0.55
72 0.55
73 0.57
74 0.52
75 0.46
76 0.51
77 0.54
78 0.55
79 0.52
80 0.59
81 0.58
82 0.58
83 0.56
84 0.53
85 0.51
86 0.48
87 0.49
88 0.47
89 0.41
90 0.4
91 0.4
92 0.35
93 0.32
94 0.36
95 0.37
96 0.37
97 0.43
98 0.49
99 0.56