Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UE55

Protein Details
Accession A0A512UE55   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
254-273SGGIRFFRIKRNQKPSDDESHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 3, extr 11, plas 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MKVISTFVNLLLLAGSTLLLLFLILSGSTVHFPFDRFYWIRAETSEIANAYDQSAWTFWGVCDYNDFSSCITGPAFPLSPADNFGTNKNIPADFIDNRNTYYYLSRFAFAFFLIAVGFSAFALLISILGFCFEVIDKVLIFLVVIGLFFVAGAAAFQTAVVVLARNAFHSQGLRAHIGVKSMAIAWAAVAVMLLVFFITCAANIANSYKKHIDRVNESRGYDNEAYASPAAHAPLGDDSSFTRGNASEKNDAESGGIRFFRIKRNQKPSDDESV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.04
4 0.04
5 0.04
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.05
14 0.06
15 0.08
16 0.08
17 0.1
18 0.1
19 0.11
20 0.13
21 0.14
22 0.21
23 0.21
24 0.22
25 0.26
26 0.28
27 0.28
28 0.27
29 0.31
30 0.25
31 0.25
32 0.26
33 0.21
34 0.2
35 0.19
36 0.19
37 0.14
38 0.13
39 0.11
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.14
47 0.14
48 0.13
49 0.16
50 0.18
51 0.2
52 0.2
53 0.21
54 0.15
55 0.16
56 0.16
57 0.13
58 0.11
59 0.1
60 0.09
61 0.11
62 0.11
63 0.1
64 0.11
65 0.12
66 0.12
67 0.14
68 0.15
69 0.15
70 0.16
71 0.17
72 0.21
73 0.2
74 0.21
75 0.21
76 0.19
77 0.17
78 0.18
79 0.21
80 0.17
81 0.2
82 0.24
83 0.22
84 0.24
85 0.25
86 0.23
87 0.19
88 0.21
89 0.19
90 0.19
91 0.19
92 0.18
93 0.17
94 0.17
95 0.16
96 0.12
97 0.12
98 0.07
99 0.06
100 0.05
101 0.05
102 0.04
103 0.03
104 0.04
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.02
111 0.03
112 0.02
113 0.03
114 0.02
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.03
147 0.03
148 0.03
149 0.03
150 0.05
151 0.06
152 0.07
153 0.08
154 0.08
155 0.09
156 0.1
157 0.11
158 0.12
159 0.15
160 0.15
161 0.14
162 0.16
163 0.16
164 0.16
165 0.14
166 0.11
167 0.09
168 0.08
169 0.08
170 0.06
171 0.06
172 0.04
173 0.05
174 0.04
175 0.04
176 0.03
177 0.03
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.03
185 0.03
186 0.03
187 0.04
188 0.04
189 0.05
190 0.06
191 0.09
192 0.14
193 0.15
194 0.2
195 0.25
196 0.27
197 0.32
198 0.36
199 0.4
200 0.43
201 0.51
202 0.55
203 0.54
204 0.54
205 0.52
206 0.49
207 0.49
208 0.4
209 0.33
210 0.25
211 0.21
212 0.22
213 0.18
214 0.18
215 0.11
216 0.11
217 0.12
218 0.1
219 0.1
220 0.09
221 0.11
222 0.12
223 0.11
224 0.11
225 0.12
226 0.16
227 0.17
228 0.16
229 0.15
230 0.15
231 0.18
232 0.23
233 0.28
234 0.31
235 0.31
236 0.35
237 0.34
238 0.33
239 0.3
240 0.28
241 0.25
242 0.22
243 0.22
244 0.19
245 0.24
246 0.26
247 0.35
248 0.42
249 0.51
250 0.56
251 0.67
252 0.75
253 0.77
254 0.83